Overview

  • Product name

  • Description

    Rabbit polyclonal to HEATR5B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Xenopus tropicalis
  • Immunogen

    Recombinant fragment corresponding to Human HEATR5B aa 740-817.
    Sequence:

    DQLQPNSASGSGALEHDPSSIYLRIPAGEAVPGPLPLGVSVIDASVALFG VVFPHVSYKHRLQMLDHFAECVKQAKGV


    Database link: Q9P2D3

  • Positive control

    • WB: RT-4 and U-251 cell lysates. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220780 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

WB 1/100 - 1/250. Predicted molecular weight: 224 kDa.

Target

Images

  • Immunofluorescent analysis of A431 cells (PFA-fixed/Triton X-100 permeabilized) labeling HEATR5B with ab220780 at 4 μg/mL (green).

  • All lanes : Anti-HEATR5B antibody (ab220780) at 1/100 dilution

    Lane 1 : RT4 cell lysate
    Lane 2 : U251 MG cell lysate

    Predicted band size: 224 kDa

References

ab220780 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220780.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up