Overview

  • Product name

  • Description

    Rabbit polyclonal to HEBP2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant full length protein corresponding to Human HEBP2 aa 2-205.
    Sequence:

    AEPLQPDPGAAEDAAAQAVETPGWKAPEDAGPQPGSYEIRHYGPAKWVST SVESMDWDSAIQTGFTKLNSYIQGKNEKEMKIKMTAPVTSYVEPGSGPFS ESTITISLYIPSEQQFDPPRPLESDVFIEDRAEMTVFVRSFDGFSSAQKN QEQLLTLASILREDGKVFDEKVYYTAGYNSPVKLLNRNNEVWLIQKNEPT KENE


    Database link: Q9Y5Z4-1

  • Positive control

    • IHC-P: Human thyroid and adrenal gland tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity greater than 95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238836 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Can promote mitochondrial permeability transition and facilitate necrotic cell death under different types of stress conditions. Does not bind hemin.
  • Tissue specificity

    Detected in placenta.
  • Sequence similarities

    Belongs to the HEBP family.
  • Domain

    Forms a distorted beta-barrel structure, with two helices that are packed against the outer surface of the barrel.
  • Cellular localization

    Cytoplasm. Mitochondrion. Mainly localized to the cytoplasm with a much lower abundance in the mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • C6orf34 antibody
    • Chromosome 6 open reading frame 34 antibody
    • Hebp2 antibody
    • HEBP2_HUMAN antibody
    • Heme binding protein 2 antibody
    • Heme-binding protein 2 antibody
    • Placental protein 23 antibody
    • PP23 antibody
    • Protein SOUL antibody
    • SOUL antibody
    see all

Images

  • Paraffin-embedded human thyroid tissue stained for HEBP2 using ab238836 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human adrenal gland tissue stained for HEBP2 using ab238836 at 1/100 dilution in immunohistochemical analysis.

References

ab238836 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238836.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up