Overview

  • Product name

  • Description

    Mouse polyclonal to HEC1/HEC
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cynomolgus monkey
  • Immunogen

    Full length protein corresponding to Human HEC1/HEC aa 1-642.
    Sequence:

    MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTS ERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLC EFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEE VPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKE SSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAEL QSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLK ASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENT RLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELK YARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCL VKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSV RTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGL SEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHL EEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE


    Database link: NP_006092

  • Positive control

    • HEC1/HEC transfected 293T cell line lysate.
  • General notes

     This product was previously labelled as HEC1

     

Properties

Applications

Our Abpromise guarantee covers the use of ab172396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 1 µg/ml. Predicted molecular weight: 74 kDa.

Target

  • Function

    Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity. Required for kinetochore integrity and the organization of stable microtubule binding sites in the outer plate of the kinetochore.
  • Sequence similarities

    Belongs to the NDC80/HEC1 family.
  • Developmental stage

    Expression peaks in mitosis.
  • Post-translational
    modifications

    Phosphorylation begins in S phase of the cell cycle and peaks in mitosis. Phosphorylated by NEK2. May also be phosphorylated by AURKA and AURKB.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Localizes to kinetochores from late prophase to anaphase. Localizes specifically to the outer plate of the kinetochore.
  • Information by UniProt
  • Database links

  • Alternative names

    • from Entrez Gene ; antibody
    • HEC antibody
    • Highly expressed in cancer antibody
    • Highly expressed in cancer protein antibody
    • Highly expressed in cancer rich in leucine heptad repeats antibody
    • HsHec1 antibody
    • hsNDC80 antibody
    • Kinetochore associated 2 antibody
    • Kinetochore associated protein 2 antibody
    • Kinetochore protein Hec1 antibody
    • Kinetochore protein NDC80 homolog antibody
    • Kinetochore-associated protein 2 antibody
    • KNTC2 antibody
    • ndc80 antibody
    • NDC80 homolog kinetochore complex component antibody
    • NDC80 kinetochore complex component homolog antibody
    • NDC80, S. cerevisiae, homolog of antibody
    • NDC80_HUMAN antibody
    • Retinoblastoma associated protein HEC antibody
    • Retinoblastoma-associated protein HEC antibody
    • TID3 antibody
    see all

Images

  • All lanes : Anti-HEC1/HEC antibody (ab172396) at 1 µg/ml

    Lane 1 : HEC1/HEC transfected 293T cell line lysate
    Lane 2 : Non-transfected 293T cell line lysate

    Lysates/proteins at 15 µl per lane.

    Secondary
    All lanes : Goat Anti-Mouse IgG (H&L)-HRP Conjugate at 1/2500 dilution

    Predicted band size: 74 kDa

References

ab172396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up