Overview

  • Product name

    Anti-Heme Oxygenase 1 antibody [1F12-A6]
    See all Heme Oxygenase 1 primary antibodies
  • Description

    Mouse monoclonal [1F12-A6] to Heme Oxygenase 1
  • Host species

    Mouse
  • Tested applications

    Suitable for: IHC-P, IP, ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Mouse, Human
    Predicted to work with: Cow, Orangutan
  • Immunogen

    Synthetic peptide corresponding to Human Heme Oxygenase 1 aa 1-30.
    Sequence:

    MERPQPDSMPQDLSEALKEATKEVHTQAEN


    Database link: P09601

  • Positive control

    • ICC/IF: HeLa and HaCaT cells. IHC: Mouse back skin. WB: HeLa cell lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab223349 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100.

Fixation: Bouin's fixative.

IP Use at an assay dependent concentration.
ICC/IF 1/100.
WB 1/1000. Predicted molecular weight: 33 kDa.

Target

  • Function

    Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed.
  • Sequence similarities

    Belongs to the heme oxygenase family.
  • Cellular localization

    Microsome. Endoplasmic reticulum.
  • Information by UniProt
  • Database links

  • Alternative names

    • 32 kD antibody
    • bK286B10 antibody
    • D8Wsu38e antibody
    • heat shock protein 32 kD antibody
    • heat shock protein 32kD antibody
    • Heat shock protein antibody
    • Heme oxygenase (decycling) 1 antibody
    • Heme oxygenase 1 antibody
    • Hemox antibody
    • HMOX 1 antibody
    • Hmox antibody
    • Hmox1 antibody
    • HMOX1_HUMAN antibody
    • HO 1 antibody
    • HO antibody
    • HO-1 antibody
    • HO1 antibody
    • Hsp32 antibody
    see all

Images

  • Anti-Heme Oxygenase 1 antibody [1F12-A6] (ab223349) at 1/1000 dilution + HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate at 15 µg

    Secondary
    Sheep Anti-Mouse IgG: HRP

    Predicted band size: 33 kDa



    Blocking: 1.5% BSA for 30 minutes at RT.

  • 2% formaldehyde fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Heme Oxygenase 1 (green) using ab223349 at a 1/100 dilution in ICC/IF. Secondary: FITC Goat Anti-Mouse at 1/200 dilution for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1/40000 dilution for 2 hours at RT.

    (A) DAPI nuclear stain (B) ab223349 (C) Merge.

     

  • Bouin's fixative, paraffin embedded mouse back skin tissue stained for Heme Oxygenase 1 (green) with ab223349 at a 1/100 dilution in immunohistochemical analysis. Secondary Antibody: FITC Goat Anti-Mouse at 1/50 for 1 hour at RT. 

  • 2% formaldehyde fixed HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for Heme Oxygenase 1 (yellow) using ab223349 at a 1/100 dilution in ICC/IF. Secondary: R-PE Goat Anti-Mouse at 1/200 dilution for 2 hours at RT. Counterstain: DAPI (blue) nuclear stain at 1/40000 dilution for 2 hours at RT.

    (A) DAPI nuclear stain (B) ab223349 (C) Merge.

  • 100% methanol fixed HaCaT (human keratinocyte cell line) cells stained for Heme Oxygenase 1 (green) using ab223349 at a 1/100 dilution in ICC/IF. Secondary: FITC Goat Anti-Mouse at 1/50 dilution for 1 hour at RT.

References

ab223349 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223349.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up