Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
Key features and details
- Mouse monoclonal [HO-1-1] to Heme Oxygenase 1
- Suitable for: WB, Flow Cyt (Intra), Sandwich ELISA, IHC-P
- Reacts with: Mouse, Rat, Cow, Dog, Human
- Isotype: IgG1
Overview
-
Product name
Anti-Heme Oxygenase 1 antibody [HO-1-1]
See all Heme Oxygenase 1 primary antibodies -
Description
Mouse monoclonal [HO-1-1] to Heme Oxygenase 1 -
Host species
Mouse -
Tested applications
Suitable for: WB, Flow Cyt (Intra), Sandwich ELISA, IHC-Pmore details -
Species reactivity
Reacts with: Mouse, Rat, Cow, Dog, Human
Predicted to work with: Pig -
Immunogen
Synthetic peptide:
MERPQPDSMPQDLSEALKEATKEVHTQAEN
, corresponding to amino acids 1-30 of Human Heme Oxygenase 1. -
Positive control
- Recombinant Human or Rat HO-1 (Hsp32) Protein. HEK293 treated with 30 uM hemin for 18hrs (see Abreview). IHC-P: FFPE human spleen normal.
-
General notes
This product was changed from ascites to tissue culture supernatant on 22nd May 2019. Please note that the dilutions may need to be adjusted accordingly. If you have any questions, please do not hesitate to contact our scientific support team.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
Preservative: 0.09% Sodium azide
Constituents: PBS, 50% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Tissue culture supernatant -
Purification notes
Purified from TCS. -
Clonality
Monoclonal -
Clone number
HO-1-1 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
-
sELISA pair antibody
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab13248 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (15) |
Use a concentration of 4 µg/ml. Detects a band of approximately 32 kDa (predicted molecular weight: 34.6 kDa).
|
Flow Cyt (Intra) |
Use at an assay dependent concentration.
ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
|
Sandwich ELISA |
Use at an assay dependent concentration. Can be paired for Sandwich ELISA with Rabbit polyclonal to Heme Oxygenase 1 (ab13243).
For sandwich ELISA, use this antibody as Capture at 5 µg/ml with Rabbit polyclonal to Heme Oxygenase 1 (ab13243) as Detection. |
|
IHC-P | (1) |
Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
|
Notes |
---|
WB
Use a concentration of 4 µg/ml. Detects a band of approximately 32 kDa (predicted molecular weight: 34.6 kDa). |
Flow Cyt (Intra)
Use at an assay dependent concentration. ab170190 - Mouse monoclonal IgG1, is suitable for use as an isotype control with this antibody. |
Sandwich ELISA
Use at an assay dependent concentration. Can be paired for Sandwich ELISA with Rabbit polyclonal to Heme Oxygenase 1 (ab13243). For sandwich ELISA, use this antibody as Capture at 5 µg/ml with Rabbit polyclonal to Heme Oxygenase 1 (ab13243) as Detection. |
IHC-P
Use at an assay dependent concentration. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Heme oxygenase cleaves the heme ring at the alpha methene bridge to form biliverdin. Biliverdin is subsequently converted to bilirubin by biliverdin reductase. Under physiological conditions, the activity of heme oxygenase is highest in the spleen, where senescent erythrocytes are sequestrated and destroyed. -
Sequence similarities
Belongs to the heme oxygenase family. -
Cellular localization
Microsome. Endoplasmic reticulum. - Information by UniProt
-
Database links
- Entrez Gene: 513221 Cow
- Entrez Gene: 442987 Dog
- Entrez Gene: 3162 Human
- Entrez Gene: 15368 Mouse
- Entrez Gene: 445512 Pig
- Entrez Gene: 24451 Rat
- Omim: 141250 Human
- SwissProt: Q5E9F2 Cow
see all -
Alternative names
- 32 kD antibody
- bK286B10 antibody
- D8Wsu38e antibody
see all
Images
-
All lanes : Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1 µg/ml
Lane 1 : Hek293
Lane 2 : HL60
Lane 3 : HeLa
Lane 4 : A549
Lane 5 : Hu spleen
Lane 6 : Ms spleen
Lane 7 : Rt spleen
Lysates/proteins at 10 µg per lane.
Secondary
All lanes : IRDye® 800CW Goat anti Mouse
Predicted band size: 34.6 kDa
Observed band size: 32 kDa why is the actual band size different from the predicted?Hek293 & HL60 presumed negative or very low expression.
Loading control GAPDH at 38kDa
This image was generated using the ascites version of the product.
-
IHC image of Hem Oxygensae 1 staining in a section of formalin fixed, paraffin embedded normal human spleen tissue section*, performed on a Leica Bond™ system using the standard protocol F. The section was pre-treated using heat mediated antigen retrieval with sodium citrate buffer (pH6, epitope retrieval solution 1) for 20 mins. The section was then incubated with ab13248, 5µg/ml, for 15 mins at room temperature and detected using an HRP conjugated compact polymer system. DAB was used as the chromogen. The section was then counterstained with haematoxylin and mounted with DPX.
This image was generated using the ascites version of the product.
For other IHC staining systems (automated and non-automated) customers should optimize variable parameters such as antigen retrieval conditions, primary antibody concentration and antibody incubation times.
*Tissue obtained from the Human Research Tissue Bank, supported by the NIHR Cambridge Biomedical Research Centre
-
The following proteins and lysates were electrophoresed; Lane 1 - Heme-Oxygenase-1 (Hsp32) Protein (50ng), lane 2 - Heme-Oxygenase-2 protein NSP-550 (100ng), lane 3 - MDBK Cell Lysate (20ug), lane 4 - Mouse liver microsome (20ug) and lane 5 - Dog liver microsome (20ug). ab13248 was applied at a concentration of 4ugml-1.
This image was generated using the ascites version of the product.
-
Standard Curve for Heme Oxygenase 1 (Analyte: Heme Oxygenase 1 protein (Tagged) (ab85243)); dilution range 1pg/ml to 1µg/ml using Capture Antibody Mouse monoclonal [HO-1-1] to Heme Oxygenase 1 (ab13248) at 5µg/ml and Detector Antibody Rabbit polyclonal to Heme Oxygenase 1 (ab13243) at 0.5µg/ml.
This image was generated using the ascites version of the product.
-
Lane 1 : MW marker
Lanes 2-7 : Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248)
Lane 2 : Recombinant Rat Heme Oxygenase 1
Lane 3 : Recombinant Human Heme Oxygenase 1
Lane 4 : Recombinant Human Heme Oxygenase 2
Lane 5 : MDBK cell lysate
Lane 6 : Dog liver microsome
Lane 7 : Mouse liver microsome
Predicted band size: 34.6 kDaThis image was generated using the ascites version of the product.
-
Anti-Heme Oxygenase 1 antibody [HO-1-1] (ab13248) at 1/250 dilution + Human microsome lysate
Predicted band size: 34.6 kDaThis image was generated using the ascites version of the product.
-
ab13248 at 10µg/ml staining Heme Oxygenase 1 in human lung cancer A2 cells by flow cytometery. The left image repersents staining with isotype control antibody and the right image show staining with ab13248.
This image was generated using the ascites version of the product.
Protocols
Datasheets and documents
-
SDS download
-
Datasheet download
References (298)
ab13248 has been referenced in 298 publications.
- Xu WN et al. Sesn2 Serves as a Regulator between Mitochondrial Unfolded Protein Response and Mitophagy in Intervertebral Disc Degeneration. Int J Biol Sci 19:571-592 (2023). PubMed: 36632468
- Zhang R et al. Curcumenol triggered ferroptosis in lung cancer cells via lncRNA H19/miR-19b-3p/FTH1 axis. Bioact Mater 13:23-36 (2022). PubMed: 35224289
- Wang Y et al. Postconditioning with Irisin Attenuates Lung Ischemia/Reperfusion Injury by Suppressing Ferroptosis via Induction of the Nrf2/HO-1 Signal Axis. Oxid Med Cell Longev 2022:9911167 (2022). PubMed: 35281462
- Xie Y et al. Four-Octyl Itaconate Attenuates UVB-Induced Melanocytes and Keratinocytes Apoptosis by Nrf2 Activation-Dependent ROS Inhibition. Oxid Med Cell Longev 2022:9897442 (2022). PubMed: 35308171
- Vallion R et al. The Inflammatory Response in Human Keratinocytes Exposed to Cinnamaldehyde Is Regulated by Nrf2. Antioxidants (Basel) 11:N/A (2022). PubMed: 35326225