Overview

  • Product name

  • Description

    Rabbit polyclonal to Hemogen
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human Hemogen aa 110-192.
    Sequence:

    PPGSITKVFPSVASPQKVVPEEHFSEICQESNIYQENFSEYQEIAVQNHS SETCQHVSEPEDLSPKMYQEISVLQDNSSKICQ


    Database link: Q9BXL5

  • Positive control

    • IHC-P: Human bone marrow tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Regulates the proliferation and differentiation of hematopoietic cells. Overexpression block the TPA-induced megakaryocytic differentiation in the K562 cell model. May also prevent cell apoptosis through the activation of the nuclear factor-kappa B (NF-kB).
  • Tissue specificity

    Expressed in hematopoietic precursor cells (at protein level). Detected in CD34+ and K562 leukemia cell line (at protein level). Expressed in bone marrow, testis, thymus. Also expressed in thymus and thyroid tumors, non-Hodgkin lymphoma, various leukemia cell lines, peripheral blood mononuclear cells (PBMCs) and bone marrow mononuclear cells (BMMCs) of patients with leukemia.
  • Developmental stage

    Expressed in fetal liver, kidney and brain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • CT155 antibody
    • EDAG antibody
    • EDAG-1 antibody
    • Erythroid differentiation-associated gene protein antibody
    • Hemgn antibody
    • HEMGN_HUMAN antibody
    • Hemogen antibody
    • Hemopoietic gene protein antibody
    • NDR antibody
    • Negative differentiation regulator protein antibody
    see all

Images

  • Paraffin-embedded human bone marrow tissue stained for Hemogen using ab224417 at 1/200 dilution in immunohistochemical analysis.

References

ab224417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up