Overview

  • Product name

  • Description

    Rabbit polyclonal to Hemoglobin
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Dog
    Predicted to work with: Human, Ferret, Badger, Giant Panda, Sea otter
  • Immunogen

    Full length native protein (purified) corresponding to Dog Hemoglobin aa 1-141.
    Sequence:

    VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSP GSAQVKAHGKKVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKL LSHCLLVTLACHHPTEFTPAVHASLDKFFAAVSTVLTSKYR


    Database link: P60529

  • Positive control

    • Canine liver and blood cell lysate; canine serum; Recombinant canine haemoglobin protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab231732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 15 kDa.

Target

  • Function

    Involved in oxygen transport from the lung to the various peripheral tissues.
  • Tissue specificity

    Red blood cells.
  • Involvement in disease

    Defects in HBA1/HBA2 may be a cause of Heinz body anemias (HEIBAN) [MIM:140700]. This is a form of non-spherocytic hemolytic anemia of Dacie type 1. After splenectomy, which has little benefit, basophilic inclusions called Heinz bodies are demonstrable in the erythrocytes. Before splenectomy, diffuse or punctate basophilia may be evident. Most of these cases are probably instances of hemoglobinopathy. The hemoglobin demonstrates heat lability. Heinz bodies are observed also with the Ivemark syndrome (asplenia with cardiovascular anomalies) and with glutathione peroxidase deficiency.
    Defects in HBA1/HBA2 are the cause of alpha-thalassemia (A-THAL) [MIM:604131]. The thalassemias are the most common monogenic diseases and occur mostly in Mediterranean and Southeast Asian populations. The hallmark of alpha-thalassemia is an imbalance in globin-chain production in the adult HbA molecule. The level of alpha chain production can range from none to very nearly normal levels. Deletion of both copies of each of the two alpha-globin genes causes alpha(0)-thalassemia, also known as homozygous alpha thalassemia. Due to the complete absence of alpha chains, the predominant fetal hemoglobin is a tetramer of gamma-chains (Bart hemoglobin) that has essentially no oxygen carrying capacity. This causes oxygen starvation in the fetal tissues leading to prenatal lethality or early neonatal death. The loss of three alpha genes results in high levels of a tetramer of four beta chains (hemoglobin H), causing a severe and life-threatening anemia known as hemoglobin H disease. Untreated, most patients die in childhood or early adolescence. The loss of two alpha genes results in mild alpha-thalassemia, also known as heterozygous alpha-thalassemia. Affected individuals have small red cells and a mild anemia (microcytosis). If three of the four alpha-globin genes are functional, individuals are completely asymptomatic. Some rare forms of alpha-thalassemia are due to point mutations (non-deletional alpha-thalassemia). The thalassemic phenotype is due to unstable globin alpha chains that are rapidly catabolized prior to formation of the alpha-beta heterotetramers.
    Note=Alpha(0)-thalassemia is associated with non-immune hydrops fetalis, a generalized edema of the fetus with fluid accumulation in the body cavities due to non-immune causes. Non-immune hydrops fetalis is not a diagnosis in itself but a symptom, a feature of many genetic disorders, and the end-stage of a wide variety of disorders.
  • Sequence similarities

    Belongs to the globin family.
  • Post-translational
    modifications

    The initiator Met is not cleaved in variant Thionville and is acetylated.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3-prime alpha-globin gene antibody
    • A gamma globin antibody
    • Alpha 1 globin antibody
    • Alpha 2 globin antibody
    • Alpha 2 globin chain antibody
    • Alpha globin antibody
    • alpha one globin antibody
    • alpha-1 globin antibody
    • Alpha-globin antibody
    • Beta globin antibody
    • CD113t C antibody
    • CD31 antibody
    • Delta globin antibody
    • Erythremia, beta-globin type, included antibody
    • Gamma 1 globin antibody
    • Gamma A hemoglobin antibody
    • Gamma globin antibody
    • Hb F Agamma antibody
    • HBA 1 antibody
    • HBA 2 antibody
    • HBA antibody
    • HBA T3 antibody
    • HBA-T2 antibody
    • HBA_HUMAN antibody
    • HBA1 antibody
    • HBA2 antibody
    • HBB antibody
    • Hbb-y antibody
    • HBD antibody
    • Hbe1 antibody
    • HBG 1 antibody
    • HBG antibody
    • HBG1 antibody
    • HBGA antibody
    • HBGR antibody
    • HBH antibody
    • Hemoglobin alpha 1 antibody
    • Hemoglobin alpha 1 chain antibody
    • hemoglobin alpha 1 globin chain antibody
    • hemoglobin alpha 2 antibody
    • Hemoglobin alpha chain antibody
    • Hemoglobin alpha locus antibody
    • Hemoglobin alpha locus 1 antibody
    • hemoglobin alpha-1 chain antibody
    • Hemoglobin beta antibody
    • Hemoglobin beta chain antibody
    • Hemoglobin beta chain complex antibody
    • Hemoglobin beta locus antibody
    • Hemoglobin gamma 1 chain antibody
    • Hemoglobin gamma A antibody
    • Hemoglobin gamma A chain antibody
    • Hemoglobin gamma antibody
    • Hemoglobin subunit alpha antibody
    • Hemoglobin subunit beta antibody
    • Hemoglobin subunit gamma 1 antibody
    • hemoglobin, gamma, regulator of antibody
    • Hemoglobin--gamma locus, 136 alanaine antibody
    • HSGGL1 antibody
    • LVV-hemorphin-7 antibody
    • Methemoglobinemia, beta-globin type, included antibody
    • MGC126895 antibody
    • MGC126897 antibody
    • Minor alpha-globin locus antibody
    • PRO2979 antibody
    see all

Images

  • Anti-Hemoglobin antibody (ab231732) at 1 µg/ml + Canine serum

    Predicted band size: 15 kDa

  • Anti-Hemoglobin antibody (ab231732) at 1 µg/ml + Canine liver lysate

    Predicted band size: 15 kDa

  • Anti-Hemoglobin antibody (ab231732) at 1 µg/ml + Canine blood cell lysate

    Predicted band size: 15 kDa

  • Anti-Hemoglobin antibody (ab231732) at 1 µg/ml + Recombinant canine Hemoglobin protein

    Predicted band size: 15 kDa

References

ab231732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up