Overview

  • Product name

    Anti-Hemojuvelin antibody [A9]
    See all Hemojuvelin primary antibodies
  • Description

    Mouse monoclonal [A9] to Hemojuvelin
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human Hemojuvelin aa 29-401. Expressed in E.coli.
    Sequence:

    LCGHAHSQCKILRCNAEYVSSTLSLRGGGSSGALRGGGGGGRGGGVGSGG LCRALRSYALCTRRTARTCRGDLAFHSAVHGIEDLMIQHNCSRQGPTAPP PPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSF HHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQ ECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQA AYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLS RSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQ AALEDARAFLPDLEKLHLFPSDA


    Database link: Q6ZVN8

  • Positive control

    • WB: Recombinant human Hemojuvelin; Rat heart tissue lysate. IHC-P: Human liver cancer, breast cancer, glioma, brain, stomach cancer and prostate cancer tissue.
  • General notes

     This product was previously labelled as Repulsive Guidance Molecule C

     

Properties

Applications

Our Abpromise guarantee covers the use of ab239492 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 5 µg/ml. Predicted molecular weight: 45 kDa.
IHC-P Use a concentration of 5 - 30 µg/ml.

Target

  • Relevance

    Mutations in Repulsive Guidance Molecule (also known as RGM-C; HJV; hemojuvelin; Hfe2) cause juvenile hemochromatosis, a severe iron overload disease. RGM-C gene expression has been characterized in the developing mouse and found to be exclusively expressed in all striated muscle and in the myocardium.
  • Cellular localization

    Cell membrane; Lipid-anchor, GPI-anchor
  • Database links

  • Alternative names

    • 2310035L15Rik antibody
    • 5230400G09Rik antibody
    • AI414844 antibody
    • AI789733 antibody
    • DL M antibody
    • Haemojuvelin antibody
    • HEMOCHROMATOSIS antibody
    • HEMOCHROMATOSIS DUE TO DEFECT IN HEMOJUVELIN antibody
    • HEMOCHROMATOSIS DUE TO DEFECT IN HEPCIDIN ANTIMICROBIAL PEPTIDE antibody
    • HEMOCHROMATOSIS JUVENILE antibody
    • Hemochromatosis type 2 (juvenile) antibody
    • Hemochromatosis type 2 antibody
    • Hemochromatosis type 2 protein antibody
    • Hemochromatosis type 2 protein homolog antibody
    • HEMOCHROMATOSIS, TYPE 2A antibody
    • HEMOCHROMATOSIS, TYPE 2B antibody
    • Hemojuvelin antibody
    • HFE 2 antibody
    • Hfe2 antibody
    • HFE2A antibody
    • HJV antibody
    • JH antibody
    • Juvenile antibody
    • MGC23953 antibody
    • OTTHUMP00000059680 antibody
    • Repulsive guidance molecule c antibody
    • RGM C antibody
    • RGM domain family member C antibody
    • RGMC antibody
    see all

Images

  • Paraffin-embedded human liver cancer tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Hemojuvelin antibody [A9] (ab239492) at 2 µg/ml + Rat heart tissue lysate

    Predicted band size: 45 kDa

  • Paraffin-embedded human breast cancer tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Hemojuvelin antibody [A9] (ab239492) at 5 µg/ml + Recombinant human protein

    Predicted band size: 45 kDa

  • Paraffin-embedded human glioma tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human brain tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate cancer tissue stained for Hemojuvelin using ab239492 at 30 μg/ml in immunohistochemical analysis. DAB staining.

References

ab239492 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab239492.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up