Overview

  • Product name

    Anti-HEP1 antibody
  • Description

    Rabbit polyclonal to HEP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HEP1 aa 113-165.
    Sequence:

    LGWFSDLNGKRNIEEILTARGEQVHRVAGEGALELVLEAAGAPTSTAAPE AGE


    Database link: Q5SXM8

  • Positive control

    • RT-4 and U-251 MG cell lysates; Human liver lysate; MCF7 cells.
  • General notes

    Previously labelled as DNL-type zinc finger protein. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 59% PBS, 40% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab221478 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/500 - 1/1000. Predicted molecular weight: 19 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • BA413M3.2 antibody
    • C9orf151 antibody
    • Chromosome 9 Open Reading Frame 151 antibody
    • DNL type zinc finger antibody
    • DNL-type zinc finger protein antibody
    • dnlz antibody
    • DNLZ_HUMAN antibody
    • HEP antibody
    • HEP1 antibody
    • Hsp70-escort protein 1 antibody
    • mtHsp70-escort protein antibody
    • RP11-413M3.2 antibody
    • TIMM15 antibody
    • Translocase Of Inner Mitochondrial Membrane 15 Homolog (Yeast) antibody
    • Translocase Of Inner Mitochondrial Membrane 15 Homolog antibody
    • ZIM17 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized MCF7 cells labeling HEP1 with ab221478 at 4 µg/ml (green).

  • All lanes : Anti-HEP1 antibody (ab221478) at 1/500 dilution

    Lane 1 : RT-4 cell lysate
    Lane 2 : U-251 MG cell lysate
    Lane 3 : Human plasma
    Lane 4 : Human liver tissue lysate

    Predicted band size: 19 kDa

References

ab221478 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221478.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up