Overview

  • Product name

  • Description

    Rabbit polyclonal to HEPACAM
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment corresponding to Human HEPACAM aa 265-415.
    Sequence:

    PSKRKQKKLEKQNSLEYMDQNDDRLKPEADTLPRSGEQERKNPMALYILK DKDSPETEENPAPEPRSATEPGPPGYSVSPAVPGRSPGLPIRSARRYPRS PARSPATGRTHSSPPRAPSSPGRSRSASRTLRTAGVHIIREQDEAGPVEI S


    Database link: Q14CZ8

  • Positive control

    • WB: MCF7 and HepG2 whole cell lysate. ICC/IF: MCF7 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236659 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.
ICC/IF 1/200 - 1/500.

Target

  • Function

    Involved in regulating cell motility and cell-matrix interactions. May inhibit cell growth through suppression of cell proliferation.
  • Sequence similarities

    Contains 1 Ig-like C2-type (immunoglobulin-like) domain.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Domain

    The cytoplasmic domain plays an important role in regulation of cell-matrix adhesion and cell motility.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cytoplasm. Membrane. In MCF7 breast carcinoma and hepatic Hep3B and HepG2 cell lines, localization of HEPACAM is cell density-dependent. In well spread cells, localized to punctate structures in the perinuclear membrane, cytoplasm, and at cell surface of protusions. In confluent cells, localized predominantly to the cytoplasmic membrane, particularly in areas of cell-cell contacts. Colocalizes with CDH1.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ25530 antibody
    • GlialCAM antibody
    • HECAM_HUMAN antibody
    • HEPACAM antibody
    • Hepatocyte cell adhesion molecule antibody
    • Protein hepaCAM antibody
    see all

Images

  • All lanes : Anti-HEPACAM antibody (ab236659) at 1/500 dilution

    Lane 1 : MCF7 (human breast adenocarcinoma cell line) whole cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution
  • MCF7 (human breast adenocarcinoma cell line) cells labeling HEPACAM (green) using ab236659 at 1/200 dilution in ICC/IF. Counterstained with DAPI (blue).

    The cells were fixed in 4% formaldehyde, permeabilized using 0.2% Triton X-100 and blocked in 10% normal Goat Serum. The cells were then incubated with the antibody overnight at 4°C. The secondary antibody was Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG (H+L).

References

ab236659 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236659.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up