Overview

  • Product name

    Anti-Heparanase 1 antibody
    See all Heparanase 1 primary antibodies
  • Description

    Rabbit polyclonal to Heparanase 1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human Heparanase 1 aa 34-115. (Expressed in E.coli).
    Sequence:

    QAQDVVDLDFFTQEPLHLVSPSFLSVTIDANLATDPRFLILLGSPKLRTL ARGLSPAYLRFGGTKTDFLIFDPKKESTFEER


    Database link: Q9Y251

  • Positive control

    • IHC-P: Human spleen tissue. WB: HeLa and HepG2 cell lysates; Recombinant human Heparanase 1 protein.

Properties

Applications

Our Abpromise guarantee covers the use of ab232817 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 61 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Endoglycosidase which is a cell surface and extracellular matrix-degrading enzyme. Cleaves heparan sulfate proteoglycans (HSPGs) into heparan sulfate side chains and core proteoglycans. Also implicated in the extravasation of leukocytes and tumor cell lines. Due to its contribution to metastasis and angiogenesis, it is considered to be a potential target for anti-cancer therapies.
  • Tissue specificity

    Highly expressed in placenta and spleen and weakly expressed in lymph node, thymus, peripheral blood leukocytes, bone marrow, endothelial cells, fetal liver and tumor tissues.
  • Sequence similarities

    Belongs to the glycosyl hydrolase 79 family.
  • Post-translational
    modifications

    Proteolytically processed. The cleavage of the 65 kDa form leads to the generation of a linker peptide, 8 kDa and 50 kDa product. The active form, the 8/50 kDa heterodimer, is resistant to degradation. Complete removal of the linker peptide appears to be a prerequisite to the complete activation of the enzyme.
    N-glycosylated. Glycosylation of the 50 kDa subunit appears to be essential for its solubility.
  • Cellular localization

    Lysosome membrane. Secreted. Secreted, internalised and transferred to late endosomes/lysosomes as a proheparanase. In lysosomes, it is processed into the active form, the heparanase. The uptake or internalisation of proheparanase is mediated by HSPGs. Heparin appears to be a competitor and retain proheparanase in the extracellular medium.
  • Information by UniProt
  • Database links

  • Alternative names

    • Endo glucoronidase antibody
    • Endo-glucoronidase antibody
    • HEP antibody
    • Heparanase 50 kDa subunit antibody
    • Heparanase antibody
    • Heparanase-1 antibody
    • Heparanase1 antibody
    • Hpa 1 antibody
    • HPA antibody
    • Hpa1 antibody
    • HPR 1 antibody
    • HPR1 antibody
    • HPSE 1 antibody
    • HPSE antibody
    • HPSE_HUMAN antibody
    • HPSE1 antibody
    • HSE 1 antibody
    • HSE1 antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human spleen tissue stained for Heparanase 1 using ab232817 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Anti-Heparanase 1 antibody (ab232817) at 3 µg/ml + Recombinant human Heparanase 1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

  • All lanes : Anti-Heparanase 1 antibody (ab232817) at 3 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : Human liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 61 kDa

References

ab232817 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232817.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up