Overview

  • Product name

    Anti-Hepatitis E Virus antibody [5F3]
    See all Hepatitis E Virus primary antibodies
  • Description

    Mouse monoclonal [5F3] to Hepatitis E Virus
  • Host species

    Mouse
  • Specificity

    This antibody recognizes the capsid protein of the HEV genotype 3. Does not react with rat HEV capsid protein.
  • Tested applications

    Suitable for: WB, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Other species
  • Immunogen

    Recombinant full length protein corresponding to Hepatitis E virus Hepatitis E Virus aa 1-660. Saccharomyces cerevisae-expressed HEV-3 isolate wbGER27 full-length capsid protein (ORF 2 protein).
    Sequence:

    MRPRAVLLLFFVFLPMLPAPPAGQPSGRRRGRRSGGAGSGFWGDRVDSQP FALPYIHPTNPFAADVVPQSGAGARPRQPSRPLGSSWRDQSQRPSAVPRR RSAPAGAAPLTAISPAPDTAPVPDVDSRGAILRRQYNLSTSPLTSSVASG TNLVLYAAPLNPLLPLQDGTNTHIMATEASNYAQYRVVRATIRYRPLVPN AVGGYAISISFWPQTTTTPTSVDMNSITSTDVRILVQPGIASELVIPSER LHYRNQGWRSVETSGVAEEEATSGLVMLCIHGSPVNSYTNTPYTGALGLL DFALELEFRNLTPGNTNTRVSRYTSTARHRLRRGADGTAELTTTAATRFM KDLHFTGTNGVGEVGRGIALTLFNLADTLLGGLPTELISSAGGQLFYSRP VVSANGEPTVKLYTSVENAQQDKGIAIPHDIDLGDSRVVVQDYDNQHEQD RPTPSPAPSRPFSVLRANDVLWLSLTAAEYDQTTYGSSTNPMYVSDTVTF VNVATGAQAVARSLDWSKVTLDGRPLTTIQQYSKTFYVLPLRGKLSFWEA GTTKAGYPYNYNTTASDQILIENAAGHRVAISTYTTSLGAGPVSVSAVGV LAPHSALAVLEDTIDYPARAHTFDDFCPECRALGLQGCAFQSTIAELQRL KMKLGKTREF


    Database link: FJ705359

  • Positive control

    • WB: HEV genotype 3 lysate. ICC/IF: ??

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.1% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Monoclonal
  • Clone number

    5F3
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233244 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.
ICC/IF 1/20 - 1/50.
ELISA 1/1000 - 1/10000.

Target

Images

  • All lanes : Anti-Hepatitis E Virus antibody [5F3] (ab233244) at 1/1000 dilution

    Lane 1 : Rat HEV capsid protein
    Lane 2 : HEV genotype 3
    Lane 3 : Human parvovirus 4 VP2 protein

    Lysates/proteins at 0.5 µg per lane.


    M - PageRuler Prestained Protein Ladder

  • HEV-3-infected cells were fixed with acetone-methanol (1:1; 20 °C) and blocked with 1% FCS, then incubated with ab233244 at 1/50 dilution for 1 h at 37°C. FITC-conjugated anti-mouse IgG at 1/100 dilution was used as the secondary antibody. Cell nuclei counterstained with DAPI (Blue).

References

This product has been referenced in:

  • Simanavicius M  et al. Generation in yeast and antigenic characterization of hepatitis E virus capsid protein virus-like particles. Appl Microbiol Biotechnol 102:185-198 (2018). Read more (PubMed: 29143081) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233244.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up