Overview

  • Product name

  • Description

    Rabbit polyclonal to HERC4
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat
  • Immunogen

    Recombinant fragment corresponding to Human HERC4 aa 5-78.
    Sequence:

    GNASFGQLGLGGIDEEIVLEPRKSDFFINKRVRDVGCGLRHTVFVLDDGT VYTCGCNDLGQLGHEKSRKKPEQV


    Database link: Q5GLZ8

  • Positive control

    • WB: RT4 and U-251 cell lysates. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab221757 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

WB 1/100 - 1/250. Predicted molecular weight: 119 kDa.

Target

  • Function

    Probable E3 ubiquitin-protein ligase involved in either protein trafficking or in the distribution of cellular structures. Required for spermatozoon maturation and fertility, and for the removal of the cytoplasmic droplet of the spermatozoon. E3 ubiquitin-protein ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer it to targeted substrates.
  • Tissue specificity

    Expressed in brain and testis and detected in heart and placenta.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Contains 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain.
    Contains 7 RCC1 repeats.
  • Developmental stage

    Expressed in fetal brain.
  • Cellular localization

    Cytoplasm > cytosol. shows a punctate cytoplasmic distribution.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZP564G092 antibody
    • HECT and RLD domain containing E3 ubiquitin protein ligase 4 antibody
    • HECT domain and RCC1 like domain containing protein 4 antibody
    • HECT domain and RCC1-like domain-containing protein 4 antibody
    • Hect domain and RLD 4 antibody
    • HERC 4 antibody
    • HERC4 antibody
    • HERC4_HUMAN antibody
    • KIAA1593 antibody
    • Probable E3 ubiquitin protein ligase HERC4 antibody
    • Probable E3 ubiquitin-protein ligase HERC4 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for HERC4 (green) using ab221757 at 4 µg/ml in ICC/IF.

  • All lanes : Anti-HERC4 antibody (ab221757) at 1/100 dilution

    Lane 1 : RT4 (human urinary bladder cancer cell line) cell lysate
    Lane 2 : U-251 MG (human brain glioma cell line) cell lysate

    Predicted band size: 119 kDa

References

ab221757 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab221757.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up