Overview

  • Product name

  • Description

    Rabbit polyclonal to HERV-FRD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Chimpanzee, Cynomolgus monkey, Gorilla, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human HERV-FRD aa 16-250.
    Sequence:

    AYRHPDFPLLEKAQQLLQSTGSPYSTNCWLCTSSSTETPGTAYPASPREW TSIEAELHISYRWDPNLKGLMRPANSLLSTVKQDFPDIRQKPPIFGPIFT NINLMGIAPICVMAKRKNGTNVGTLPSTVCNVTFTVDSNQQTYQTYTHNQ FRHQPRFPKPPNITFPQGTLLDKSSRFCQGRPSSCSTRNFWFRPADYNQC LQISNLSSTAEWVLLDQTRNSLFWENKTKGANQSQ


    Database link: P60508

  • Positive control

    • Human kidney and adrenal gland tissue.
  • General notes

    Previously labeled as HERV.

Properties

Applications

Our Abpromise guarantee covers the use of ab230198 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has retained its original fusogenic properties. Can make pseudotypes with MLV, HIV-1 or SIV-1 virions and confer infectivity.
    SU mediates receptor recognition.
    TM anchors the envelope heterodimer to the viral membrane through one transmembrane domain. The other hydrophobic domain, called fusion peptide, mediates fusion of the viral membrane with the target cell membrane.
  • Tissue specificity

    Expressed at higher level in placenta. Expressed at lower level in adrenal, bone marrow, brain, breast, colon, kidney, lung, ovary, peripheral blood lymphocytes, prostate, skin, spleen, testis, thymus, thyroid, trachea.
  • Sequence similarities

    Belongs to the gamma type-C retroviral envelope protein family. HERV class-I FRD env subfamily.
  • Domain

    Contains the CKS-17 immunosuppressive domain present in many retroviral envelope proteins. As a synthetic peptide, it inhibits immune function in vitro and in vivo.
  • Post-translational
    modifications

    Specific enzymatic cleavages in vivo yield the mature SU and TM proteins.
    The CXXC motif is highly conserved across a broad range of retroviral envelope proteins. It is thought to participate in the formation of a labile disulfide bond possibly with the CX6CC motif present in the transmembrane protein. Isomerization of the intersubunit disulfide bond to an SU intrachain disulfide bond is thought to occur upon receptor recognition in order to allow membrane fusion.
  • Cellular localization

    Cell membrane and Virion.
  • Information by UniProt
  • Database links

  • Alternative names

    • EFRD1_HUMAN antibody
    • Endogenous retrovirus group FRD member 1 antibody
    • Envelope polyprotein antibody
    • ERVFRD-1 antibody
    • FLJ41944 antibody
    • FLJ90611 antibody
    • GLLL6191 antibody
    • HERV FRD 6p24.1 provirus ancestral Env polyprotein antibody
    • HERV FRD antibody
    • HERV FRD provirus ancestral Env polyprotein antibody
    • HERV-FRD antibody
    • HERVFRD antibody
    • HERVFRD provirus ancestral Env polyprotein antibody
    • MGC87585 antibody
    • SU antibody
    • Syncytin 2 antibody
    • Syncytin B antibody
    • Syncytin-2 antibody
    • TM antibody
    • Transmembrane protein antibody
    • UNQ6191 antibody
    see all

Images

  • Paraffin-embedded human adrenal gland tissue stained for HERV-FRD using ab230198 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for HERV-FRD using ab230198 at 1/100 dilution in immunohistochemical analysis.

References

ab230198 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230198.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up