Anti-HES6 antibody (ab172800)
Key features and details
- Mouse polyclonal to HES6
- Suitable for: WB
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-HES6 antibody
See all HES6 primary antibodies -
Description
Mouse polyclonal to HES6 -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human
Predicted to work with: Mouse -
Immunogen
Full length protein corresponding to Human HES6 aa 1-224.
Sequence:MAPPAAPGRDRVGREDEDGWETRGDRKARKPLVEKKRRARINESLQELRL LLAGAEVQAKLENAEVLELTVRRVQGVLRGRAREREQLQAEASERFAAGY IQCMHEVHTFVSTCQAIDATVAAELLNHLLESMPLREGSSFQDLLGDALA GPPRAPGRSGWPAGGAPGSPIPSPPGPGDDLCSDLEEAPEAELSQAPAEG PDLVPAALGSLTTAQIARSVWRPW
Database link: NP_061115.2 -
Positive control
- HES6 transfected 293T cell lysate.
-
General notes
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Constituent: 100% PBS -
Concentration information loading...
-
Purity
Protein A purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
-
Related Products
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab172800 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa.
|
Notes |
---|
WB
Use a concentration of 1 µg/ml. Predicted molecular weight: 24 kDa. |
Target
-
Relevance
HES6 is a transcription cofactor that iteself does not bind to DNA but suppresses both HES1-mediated N box-dependent transcriptional repression and binding of HES1 to E box sequences. It also suppresses HES1-mediated inhibition of the heterodimer formed by ASCL1/MASH1 and TCFEA2/E47, allowing ASCL1 and TCFEA2 to upregulate transcription in its presence. HES6 appears to have novel functions in tumour and cancer cell lines, although these have not yet been elucidated fully. -
Cellular localization
Nuclear -
Database links
- Entrez Gene: 55502 Human
- Entrez Gene: 55927 Mouse
- Omim: 610331 Human
- SwissProt: Q96HZ4 Human
- SwissProt: Q9JHE6 Mouse
- Unigene: 42949 Human
- Unigene: 280029 Mouse
-
Alternative names
- bHLHb41 antibody
- bHLHc23 antibody
- C HAIRY1 antibody
see all
Images
Datasheets and documents
-
SDS download
-
Datasheet download
References (0)
ab172800 has not yet been referenced specifically in any publications.