Heteropodatoxin-2 (HpTX2), Kv4.3 voltage-gated K+ channel blocker (ab141874)


  • Product name

    Heteropodatoxin-2 (HpTX2), Kv4.3 voltage-gated K+ channel blocker
  • Description

    Specific Kv4.3 voltage-gated K+ channel blocker
  • Biological description

    Specific Kv4.3 voltage-gated K+ channel blocker. Peptide toxin. Acts as a gating modifier of the Kv4.1 channel. Lacks affinity for Kv1.4, Kv2.1, and Kv3.4 channels.
  • Purity

    > 98%
  • Chemical structure

    Chemical Structure


  • Molecular weight

  • Molecular formula

  • Sequence

    DDCGKLFSGCDTNADCCEGYVCRLWCKLDW (Modifications: C-terminal amide; Disulfide bonds: 3-17, 10-22, 16-26)
  • Storage instructions

    Store at -20°C. Store under desiccating conditions. The product can be stored for up to 12 months.
  • Solubility overview

    Soluble in water
  • Handling

    Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour.

    Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

  • Source

    Heteropoda venatoria

  • Research areas


  • Heteropodatoxin-2 inhibits KV4.2 channel currents expressed in Xenopus oocytes.

    Currents were elicited by application of voltage step from a holding potential of -100 mV to 0 mV in 100 msec, delivered every 10 seconds. A. Time course of channel activity (current amplitude at +0 mV), before (black) and during (green) application of 100 nM Heteropodatoxin-2 (ab141874). B. Example of superimposed current traces before (black) and during (green) application of 100 nM Heteropodatoxin-2, taken from the experiment in A.


This product has been referenced in:

  • DeSimone CV  et al. Heteropoda toxin 2 interaction with Kv4.3 and Kv4.1 reveals differences in gating modification. Mol Pharmacol 80:345-55 (2011). Read more (PubMed: 21540294) »
  • Zarayskiy VV  et al. Heteropoda toxin 2 is a gating modifier toxin specific for voltage-gated K+ channels of the Kv4 family. Toxicon 45:431-42 (2005). Read more (PubMed: 15733564) »
  • Sanguinetti MC  et al. Heteropodatoxins: peptides isolated from spider venom that block Kv4.2 potassium channels. Mol Pharmacol 51:491-8 (1997). Read more (PubMed: 9058605) »

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab141874.
Please use the links above to contact us or submit feedback about this product.

For licensing inquiries, please contact partnerships@abcam.com

Sign up