Overview

  • Product name

  • Description

    Rabbit polyclonal to Hex
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Chicken
  • Immunogen

    Recombinant fragment corresponding to Human Hex aa 91-163.
    Sequence:

    YGPGGFGGPLYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGG QVRFSNDQTIELEKKFETQKYLS


    Database link: Q03014

  • Positive control

    • HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab220764 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Use PFA/Triton X-100 Fixation/Permeabilization.

Target

  • Function

    Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.
  • Tissue specificity

    Liver and promyelocytic leukemia cell line HL60.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Expressed during hematopoiesis.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hematopoietically expressed homeobox antibody
    • Hematopoietically-expressed homeobox protein HHEX antibody
    • HEX antibody
    • HHEX antibody
    • HHEX_HUMAN antibody
    • HMPH antibody
    • Homeobox hematopoietically expressed antibody
    • Homeobox protein HEX antibody
    • Homeobox protein PRH antibody
    • HOX11L PEN antibody
    • PRH antibody
    • PRHX antibody
    • Proline rich homeodomain containing transcription factor antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed, Triton X-100 permeabilized HepG2 cells labeling Hex with ab220764 at 4 µg/ml (green).

References

ab220764 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220764.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up