Overview

  • Product name

    Anti-Hex antibody [OTI3E6]
    See all Hex primary antibodies
  • Description

    Mouse monoclonal [OTI3E6] to Hex
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human Hex aa 100-270. Produced in E.coli (NP_002720).
    Sequence:

    LYPFPRTVNDYTHALLRHDPLGKPLLWSPFLQRPLHKRKGGQVRFSNDQT IELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQEN PQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCSPSPASQEDLESE ISEDSDQEVDIEGDKSYFNAG


    Database link: Q03014

  • Positive control

    • WB: HEK-293T cells lysate transfected with pCMV6-ENTRY Hex cDNA; HepG2 and HT-29 cell lysates. ICC/IF: HT-29 cells
  • General notes

    Clone OTI3E6 (formerly 3E6).

Properties

Applications

Our Abpromise guarantee covers the use of ab117864 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/1000. Predicted molecular weight: 30 kDa.
ICC/IF 1/100.

Target

  • Function

    Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.
  • Tissue specificity

    Liver and promyelocytic leukemia cell line HL60.
  • Sequence similarities

    Contains 1 homeobox DNA-binding domain.
  • Developmental stage

    Expressed during hematopoiesis.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hematopoietically expressed homeobox antibody
    • Hematopoietically-expressed homeobox protein HHEX antibody
    • HEX antibody
    • HHEX antibody
    • HHEX_HUMAN antibody
    • HMPH antibody
    • Homeobox hematopoietically expressed antibody
    • Homeobox protein HEX antibody
    • Homeobox protein PRH antibody
    • HOX11L PEN antibody
    • PRH antibody
    • PRHX antibody
    • Proline rich homeodomain containing transcription factor antibody
    see all

Images

  • All lanes : Anti-Hex antibody [OTI3E6] (ab117864) at 1/1000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with pCMV6-ENTRY control
    Lane 2 : HEK-293T cells lysate transfected with pCMV6-ENTRY Hex cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 30 kDa

  • All lanes : Anti-Hex antibody [OTI3E6] (ab117864) at 1/1000 dilution

    Lane 1 : HepG2 (human liver hepatocellular carcinoma cell line) cell extract
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell extract
    Lane 3 : HT-29 (human colorectal adenocarcinoma cell line) cell extract
    Lane 4 : A549 (human lung carcinoma cell line) cell extract
    Lane 5 : COS-7 (african green monkey kidney fibroblast-like cell line) cell extract
    Lane 6 : Jurkat (human T cell leukemia cell line from peripheral blood) cell extract
    Lane 7 : MDCK (canine kidney cell line) cell extract
    Lane 8 : PC-12 (rat adrenal gland pheochromocytoma cell line) cell extract
    Lane 9 : MCF7 (human breast adenocarcinoma cell line) cell extract

    Lysates/proteins at 35 µg per lane.

    Predicted band size: 30 kDa

  • HT-29 (human colorectal adenocarcinoma cell line) cells stained for Hex (green) using ab117864 at 1/100 dilution in ICC/IF.

References

ab117864 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (H9 embryonic stem cells)
Specification
H9 embryonic stem cells
Blocking step
Serum as blocking agent for 10 minute(s) · Concentration: 5% · Temperature: 4°C
Fixative
Paraformaldehyde

Abcam user community

Verified customer

Submitted Oct 22 2014

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up