Overview

  • Product name

  • Description

    Rabbit polyclonal to HEXA
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
    Predicted to work with: Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HEXA aa 318-529. N-terminal tags. Expressed in E. coli.
    Sequence:

    HLGGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYG KGYVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLS APWYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNT NLVPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPL NVGFCEQEFEQT


    Database link: P06865

  • Positive control

    • WB: Recombinant human HEXA protein; rat testis and cerebrum tissue lysate; HepG2 whole cell lysate. IHC-P: Human kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab232889 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 61 kDa.

Target

  • Function

    Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. The form B is active against certain oligosaccharides. The form S has no measurable activity.
  • Involvement in disease

    Defects in HEXA are the cause of GM2-gangliosidosis type 1 (GM2G1) [MIM:272800]; also known as Tay-Sachs disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G1 is characterized by GM2 gangliosides accumulation in the absence of HEXA activity, leading to neurodegeneration and, in the infantile form, death in early childhood. GM2G1 has an increased incidence among Ashkenazi Jews and French Canadians in eastern Quebec. It exists in several forms: infantile (most common and most severe), juvenile and adult (late onset).
  • Sequence similarities

    Belongs to the glycosyl hydrolase 20 family.
  • Post-translational
    modifications

    N-linked glycan at Asn-115 consists of Man(3)-GlcNAc(2).
  • Cellular localization

    Lysosome.
  • Information by UniProt
  • Database links

  • Alternative names

    • Beta hexosaminidase alpha chain precursor antibody
    • Beta hexosaminidase subunit alpha antibody
    • Beta N acetylhexosaminidase antibody
    • Beta N acetylhexosaminidase subunit alpha antibody
    • Beta-hexosaminidase A antibody
    • Beta-hexosaminidase subunit alpha antibody
    • Beta-N-acetylhexosaminidase subunit alpha antibody
    • Hexa antibody
    • HEXA_HUMAN antibody
    • Hexosaminidase A (alpha polypeptide) antibody
    • Hexosaminidase A alpha polypeptide antibody
    • Hexosaminidase A antibody
    • Hexosaminidase subunit A antibody
    • MGC99608 antibody
    • N acetyl beta glucosaminidase antibody
    • N acetyl beta glucosaminidase subunit alpha antibody
    • N-acetyl-beta-glucosaminidase subunit alpha antibody
    • TSD antibody
    see all

Images

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for HEXA using ab232889 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Anti-HEXA antibody (ab232889) at 1 µg/ml + Rat testis tissue lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 61 kDa

  • Anti-HEXA antibody (ab232889) at 1 µg/ml + HepG2 (human liver hepatocellular carcinoma cell line) whole cell lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 61 kDa

  • Anti-HEXA antibody (ab232889) at 1 µg/ml + Rat cerebrum lysate

    Secondary
    HRP-Linked Goat anti-Rabbit IgG polyclonal at 0.2 µg/ml

    Predicted band size: 61 kDa

  • Anti-HEXA antibody (ab232889) at 1 µg/ml + Recombinant human HEXA protein

    Predicted band size: 61 kDa

References

ab232889 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232889.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up