Anti-HEXA antibody - C-terminal (ab189865)
Key features and details
- Rabbit polyclonal to HEXA - C-terminal
- Suitable for: WB
- Reacts with: Mouse, Rat, Human
- Isotype: IgG
Overview
-
Product name
Anti-HEXA antibody - C-terminal
See all HEXA primary antibodies -
Description
Rabbit polyclonal to HEXA - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Orangutan -
Immunogen
Recombinant fragment corresponding to Human HEXA aa 270-529 (C terminal).
Sequence:IPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHL GGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKG YVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP WYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNL VPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNV GFCEQEFEQT
Database link: P06865 -
Positive control
- WB: MCF7, BT474, SW620, HepG2 and HT29 cell lysates; mouse testis and brain tissue lysates.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab189865 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | 1/500 - 1/2000. Predicted molecular weight: 61 kDa. |
Target
-
Function
Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. The form B is active against certain oligosaccharides. The form S has no measurable activity. -
Involvement in disease
Defects in HEXA are the cause of GM2-gangliosidosis type 1 (GM2G1) [MIM:272800]; also known as Tay-Sachs disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G1 is characterized by GM2 gangliosides accumulation in the absence of HEXA activity, leading to neurodegeneration and, in the infantile form, death in early childhood. GM2G1 has an increased incidence among Ashkenazi Jews and French Canadians in eastern Quebec. It exists in several forms: infantile (most common and most severe), juvenile and adult (late onset). -
Sequence similarities
Belongs to the glycosyl hydrolase 20 family. -
Post-translational
modificationsN-linked glycan at Asn-115 consists of Man(3)-GlcNAc(2). -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 504468 Cow
- Entrez Gene: 3073 Human
- Entrez Gene: 15211 Mouse
- Entrez Gene: 300757 Rat
- Omim: 606869 Human
- SwissProt: Q0V8R6 Cow
- SwissProt: P06865 Human
- SwissProt: P29416 Mouse
see all -
Alternative names
- Beta hexosaminidase alpha chain precursor antibody
- Beta hexosaminidase subunit alpha antibody
- Beta N acetylhexosaminidase antibody
see all
Images
-
All lanes : Anti-HEXA antibody - C-terminal (ab189865) at 1/1000 dilution
Lane 1 : MCF-7 cell lysate
Lane 2 : BT-474 cell lysate
Lane 3 : SW620 cell lysate
Lane 4 : HepG2 cell lysate
Lane 5 : HT-29 cell lysate
Lane 6 : Mouse testis tissue lysate
Lane 7 : Mouse brain tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 61 kDa
Exposure time: 5 secondsBlocking buffer: 3% nonfat dry milk in TBST.
Protocols
Datasheets and documents
References (0)
ab189865 has not yet been referenced specifically in any publications.