For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

Supporting our customers and employees during the COVID-19 pandemic. Read more

  1. Link

    hexa-antibody-c-terminal-ab189865.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Tags & Cell Markers Subcellular Markers Organelles Lysosome
Share by email

Anti-HEXA antibody - C-terminal (ab189865)

  • Datasheet
Submit a review Submit a question

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Western blot - Anti-HEXA antibody - C-terminal (ab189865)

    Key features and details

    • Rabbit polyclonal to HEXA - C-terminal
    • Suitable for: WB
    • Reacts with: Mouse, Rat, Human
    • Isotype: IgG

    You may also be interested in

    Protein
    Product image
    Recombinant Human HEXA protein (ab198482)
    Secondary
    Product image
    Goat Anti-Rabbit IgG H&L (HRP) (ab205718)

    View more associated products

    Overview

    • Product name

      Anti-HEXA antibody - C-terminal
      See all HEXA primary antibodies
    • Description

      Rabbit polyclonal to HEXA - C-terminal
    • Host species

      Rabbit
    • Tested applications

      Suitable for: WBmore details
    • Species reactivity

      Reacts with: Mouse, Rat, Human
      Predicted to work with: Cow, Orangutan
    • Immunogen

      Recombinant fragment corresponding to Human HEXA aa 270-529 (C terminal).
      Sequence:

      IPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHL GGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKG YVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP WYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNL VPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNV GFCEQEFEQT


      Database link: P06865
      Run BLAST with BLAST the sequence with ExPASy Run BLAST with BLAST the sequence with NCBI
    • Positive control

      • WB: MCF7, BT474, SW620, HepG2 and HT29 cell lysates; mouse testis and brain tissue lysates.
    • General notes

      Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.

      Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.

      We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.

      In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.

      We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.

      Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.

      Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.

    Properties

    • Form

      Liquid
    • Storage instructions

      Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
    • Storage buffer

      pH: 7.30
      Preservative: 0.02% Sodium azide
      Constituents: 49% PBS, 50% Glycerol
    • Concentration information loading...
    • Purity

      Immunogen affinity purified
    • Clonality

      Polyclonal
    • Isotype

      IgG
    • Research areas

      • Tags & Cell Markers
      • Subcellular Markers
      • Organelles
      • Lysosome
      • Neuroscience
      • Neurology process
      • Neurodegenerative disease
      • Other
      • Neuroscience
      • Neurology process
      • Neurogenesis

    Associated products

    • Compatible Secondaries

      • Goat Anti-Rabbit IgG H&L (Alexa Fluor® 488) (ab150077)
      • Goat Anti-Rabbit IgG H&L (HRP) (ab205718)
    • Isotype control

      • Rabbit IgG, polyclonal - Isotype Control (ChIP Grade) (ab171870)
    • Positive Controls

      • HepG2 whole cell lysate (ab166833)
      • Mouse testis normal tissue lysate - total protein (ab29289)
      • Mouse brain tissue lysate - total protein (ab30151)
      • HT29 whole cell lysate (ab3952)
    • Recombinant Protein

      • Recombinant Human HEXA protein (ab198482)
    • Related Products

      • Recombinant Human HEXA protein (denatured) (ab140049)

    Applications

    Our Abpromise guarantee covers the use of ab189865 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    Application Abreviews Notes
    WB 1/500 - 1/2000. Predicted molecular weight: 61 kDa.

    Target

    • Function

      Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. The form B is active against certain oligosaccharides. The form S has no measurable activity.
    • Involvement in disease

      Defects in HEXA are the cause of GM2-gangliosidosis type 1 (GM2G1) [MIM:272800]; also known as Tay-Sachs disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G1 is characterized by GM2 gangliosides accumulation in the absence of HEXA activity, leading to neurodegeneration and, in the infantile form, death in early childhood. GM2G1 has an increased incidence among Ashkenazi Jews and French Canadians in eastern Quebec. It exists in several forms: infantile (most common and most severe), juvenile and adult (late onset).
    • Sequence similarities

      Belongs to the glycosyl hydrolase 20 family.
    • Post-translational
      modifications

      N-linked glycan at Asn-115 consists of Man(3)-GlcNAc(2).
    • Cellular localization

      Lysosome.
    • Target information above from: UniProt accession P06865 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt
    • Database links

      • Entrez Gene: 504468 Cow
      • Entrez Gene: 3073 Human
      • Entrez Gene: 15211 Mouse
      • Entrez Gene: 300757 Rat
      • Omim: 606869 Human
      • SwissProt: Q0V8R6 Cow
      • SwissProt: P06865 Human
      • SwissProt: P29416 Mouse
      • SwissProt: Q641X3 Rat
      • Unigene: 604479 Human
      • Unigene: 709495 Human
      • Unigene: 2284 Mouse
      • Unigene: 92939 Rat
      see all
    • Alternative names

      • Beta hexosaminidase alpha chain precursor antibody
      • Beta hexosaminidase subunit alpha antibody
      • Beta N acetylhexosaminidase antibody
      • Beta N acetylhexosaminidase subunit alpha antibody
      • Beta-hexosaminidase A antibody
      • Beta-hexosaminidase subunit alpha antibody
      • Beta-N-acetylhexosaminidase subunit alpha antibody
      • Hexa antibody
      • HEXA_HUMAN antibody
      • Hexosaminidase A (alpha polypeptide) antibody
      • Hexosaminidase A alpha polypeptide antibody
      • Hexosaminidase A antibody
      • Hexosaminidase subunit A antibody
      • MGC99608 antibody
      • N acetyl beta glucosaminidase antibody
      • N acetyl beta glucosaminidase subunit alpha antibody
      • N-acetyl-beta-glucosaminidase subunit alpha antibody
      • TSD antibody
      see all

    Images

    • Western blot - Anti-HEXA antibody - C-terminal (ab189865)
      Western blot - Anti-HEXA antibody - C-terminal (ab189865)
      All lanes : Anti-HEXA antibody - C-terminal (ab189865) at 1/1000 dilution

      Lane 1 : MCF-7 cell lysate
      Lane 2 : BT-474 cell lysate
      Lane 3 : SW620 cell lysate
      Lane 4 : HepG2 cell lysate
      Lane 5 : HT-29 cell lysate
      Lane 6 : Mouse testis tissue lysate
      Lane 7 : Mouse brain tissue lysate

      Lysates/proteins at 25 µg per lane.

      Secondary
      All lanes : HRP Goat Anti-Rabbit IgG (H+L)

      Developed using the ECL technique.

      Predicted band size: 61 kDa


      Exposure time: 5 seconds


      Blocking buffer: 3% nonfat dry milk in TBST.

    Protocols

    • Western blot protocols
    • Immunohistochemistry protocols

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab189865? Please let us know so that we can cite the reference in this datasheet.

    ab189865 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    There are currently no Customer reviews or Questions for ab189865.
    Please use the links above to contact us or submit feedback about this product.

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.