Anti-HEXA antibody - C-terminal (ab189865)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HEXA antibody - C-terminal
See all HEXA primary antibodies -
Description
Rabbit polyclonal to HEXA - C-terminal -
Host species
Rabbit -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Mouse, Rat, Human
Predicted to work with: Cow, Orangutan
-
Immunogen
Recombinant fragment corresponding to Human HEXA aa 270-529 (C terminal).
Sequence:IPGLLTPCYSGSEPSGTFGPVNPSLNNTYEFMSTFFLEVSSVFPDFYLHL GGDEVDFTCWKSNPEIQDFMRKKGFGEDFKQLESFYIQTLLDIVSSYGKG YVVWQEVFDNKVKIQPDTIIQVWREDIPVNYMKELELVTKAGFRALLSAP WYLNRISYGPDWKDFYIVEPLAFEGTPEQKALVIGGEACMWGEYVDNTNL VPRLWPRAGAVAERLWSNKLTSDLTFAYERLSHFRCELLRRGVQAQPLNV GFCEQEFEQT
Database link: P06865 -
Positive control
- WB: MCF7, BT474, SW620, HepG2 and HT29 cell lysates; mouse testis and brain tissue lysates.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.3
Preservative: 0.02% Sodium azide
Constituents: 49% PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Positive Controls
-
Recombinant Protein
-
Related Products
Applications
Our Abpromise guarantee covers the use of ab189865 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| WB | 1/500 - 1/2000. Predicted molecular weight: 61 kDa. |
Target
-
Function
Responsible for the degradation of GM2 gangliosides, and a variety of other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. The form B is active against certain oligosaccharides. The form S has no measurable activity. -
Involvement in disease
Defects in HEXA are the cause of GM2-gangliosidosis type 1 (GM2G1) [MIM:272800]; also known as Tay-Sachs disease. GM2-gangliosidosis is an autosomal recessive lysosomal storage disease marked by the accumulation of GM2 gangliosides in the neuronal cells. GM2G1 is characterized by GM2 gangliosides accumulation in the absence of HEXA activity, leading to neurodegeneration and, in the infantile form, death in early childhood. GM2G1 has an increased incidence among Ashkenazi Jews and French Canadians in eastern Quebec. It exists in several forms: infantile (most common and most severe), juvenile and adult (late onset). -
Sequence similarities
Belongs to the glycosyl hydrolase 20 family. -
Post-translational
modificationsN-linked glycan at Asn-115 consists of Man(3)-GlcNAc(2). -
Cellular localization
Lysosome. - Information by UniProt
-
Database links
- Entrez Gene: 504468 Cow
- Entrez Gene: 3073 Human
- Entrez Gene: 15211 Mouse
- Entrez Gene: 300757 Rat
- Omim: 606869 Human
- SwissProt: Q0V8R6 Cow
- SwissProt: P06865 Human
- SwissProt: P29416 Mouse
see all -
Alternative names
- Beta hexosaminidase alpha chain precursor antibody
- Beta hexosaminidase subunit alpha antibody
- Beta N acetylhexosaminidase antibody
see all
Images
-
Western blot - Anti-HEXA antibody - C-terminal (ab189865)All lanes : Anti-HEXA antibody - C-terminal (ab189865) at 1/1000 dilution
Lane 1 : MCF-7 cell lysate
Lane 2 : BT-474 cell lysate
Lane 3 : SW620 cell lysate
Lane 4 : HepG2 cell lysate
Lane 5 : HT-29 cell lysate
Lane 6 : Mouse testis tissue lysate
Lane 7 : Mouse brain tissue lysate
Lysates/proteins at 25 µg per lane.
Secondary
All lanes : HRP Goat Anti-Rabbit IgG (H+L)
Developed using the ECL technique.
Predicted band size: 61 kDa
Exposure time: 5 secondsBlocking buffer: 3% nonfat dry milk in TBST.
Datasheets and documents
References
ab189865 has not yet been referenced specifically in any publications.
