Overview

  • Product name

  • Description

    Rabbit polyclonal to HEXIM2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant full length protein corresponding to Human HEXIM2 aa 1-286.
    Sequence:

    MMATPNQTACNAESPVALEEAKTSGAPGSPQTPPERHDSGGSLPLTPRME SHSEDEDLAGAVGGLGWNSRSPRTQSPGGCSAEAVLARKKHRRRPSKRKR HWRPYLELSWAEKQQRDERQSQRASRVREEMFAKGQPVAPYNTTQFLMND RDPEEPNLDVPHGISHPGSSGESEAGDSDGRGRAHGEFQRKDFSETYERF HTESLQGRSKQELVRDYLELEKRLSQAEEETRRLQQLQACTGQQSCRQVE ELAAEVQRLRTENQRLRQENQMWNREGCRCDEEPGT


    Database link: Q96MH2

  • Positive control

    • WB: Rat liver and mouse kidney tissue lysates. IHC-P: Human testis tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purity >95%.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab234979 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000. Predicted molecular weight: 32 kDa.
IHC-P 1/20 - 1/200.

Target

  • Function

    Transcriptional regulator which functions as a general RNA polymerase II transcription inhibitor. In cooperation with 7SK snRNA sequesters P-TEFb in a large inactive 7SK snRNP complex preventing RNA polymerase II phosphorylation and subsequent transcriptional elongation.
  • Tissue specificity

    Ubiquitously expressed with higher expression in testis. HEXIM1 and HEXIM2 are differentially expressed.
  • Sequence similarities

    Belongs to the HEXIM family.
  • Domain

    The coiled-coil domain mediates oligomerization.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hexamethylene bis-acetamide-inducible protein 2 antibody
    • Hexamthylene bis-acetamide inducible 2 antibody
    • HEXI2_HUMAN antibody
    • hexim 2 antibody
    • HEXIM2 antibody
    • L3 antibody
    • Protein HEXIM2 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for HEXIM2 with ab234979 at 1/100 dilution in immunohistochemical analysis.

  • All lanes : Anti-HEXIM2 antibody (ab234979) at 1/500 dilution

    Lane 1 : Rat liver tissue lysate
    Lane 2 : Mouse kidney tissue lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/50000 dilution

    Predicted band size: 32 kDa

References

ab234979 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab234979.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up