Overview

  • Product name

  • Description

    Rabbit polyclonal to HEXO
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HEXO aa 1-66.
    Sequence:

    EDPQSKEPAGEAVALALLESPRPEGGEEPPRPSPEETQQCKFDGQETKGS KFITSSASDFSDPVY


    Database link: Q8IV48

  • Positive control

    • IHC-P: Human testis and small intestine tissues. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab236945 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF 1/50 - 1/200.
IHC-P 1/200 - 1/500.

Target

  • Function

    RNA exonuclease that binds to the 3'-end of histone mRNAs and degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. A 2' and 3'-hydroxyl groups at the last nucleotide of the histone 3'-end is required for efficient degradation of RNA substrates. Also able to degrade the 3'-overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as regulator of RNA interference (RNAi). Requires for binding the 5'-ACCCA-3' sequence present in stem-loop structure. Able to bind other mRNAs. Required for 5.8S rRNA 3'-end processing. Also binds to 5.8s ribosomal RNA. Binds with high affinity to the stem-loop structure of replication-dependent histone pre-mRNAs.
  • Sequence similarities

    Contains 1 exonuclease domain.
    Contains 1 SAP domain.
  • Domain

    The SAP domain is necessary for binding to the stem-loop structure of histone mRNAs and to form the ternary complex with SLBP, but not for 3'-end histone mRNA exonuclease activity.
  • Cellular localization

    Cytoplasm. Nucleus. Nucleus > nucleolus.
  • Information by UniProt
  • Database links

  • Alternative names

    • 3' 5' exonuclease ERI 1 antibody
    • 3' 5' exonuclease ERI1 antibody
    • 3' EXO antibody
    • 3' exoribonuclease antibody
    • 3' HEXO antibody
    • 3' histone mRNA exonuclease 1 antibody
    • 3''-5'' exonuclease eri1 antibody
    • 3''-5'' exoribonuclease 1 antibody
    • 3'EXO antibody
    • 3'HEXO antibody
    • ERI 1 antibody
    • Eri 1 homolog antibody
    • Eri-1 homolog antibody
    • eri1 antibody
    • Eri1 homolog antibody
    • ERI1_HUMAN antibody
    • HEXO antibody
    • Histone mRNA 3' end specific exonuclease antibody
    • Histone mRNA 3' end specific exoribonuclease antibody
    • Histone mRNA 3''-end-specific exoribonuclease antibody
    • Histone mRNA 3''-exonuclease 1 antibody
    • MGC35395 antibody
    • Protein 3''hExo antibody
    • THEX 1 antibody
    • THEX1 antibody
    • Three prime histone mRNA exonuclease 1 antibody
    see all

Images

  • Paraffin-embedded human testis tissue stained for HEXO using ab236945 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • 4% formaldehyde-fixed, 0.2% Triton X-100 permeabilized HepG2 (human liver hepatocellular carcinoma cell line) cells stained for HEXO (green) using ab236945 at 1/133 dilution in ICC/IF, followed by Alexa Fluor 488® conjugated Goat Anti-Rabbit IgG (H+L). Counter-stained with DAPI.

  • Paraffin-embedded human small intestine tissue stained for HEXO using ab236945 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum 30min at RT. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab236945 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab236945.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up