Overview

  • Product name

    Anti-HFBI antibody
  • Description

    Rabbit polyclonal to HFBI
  • Host species

    Rabbit
  • Specificity

    Predicted to react with Hypocrea jecorina.
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Species independent
  • Immunogen

    Recombinant full length protein corresponding to HFBI aa 23-97. Hypocrea jecorina
    Sequence:

    SNGNGNVCPPGLFSNPQCCATQVLGLIGLDCKVPSQNVYDGTDFRNVCAK TGAQPLCCVAPVAGQALLCQTAVGA


    Database link: P52754

  • Positive control

    • WB: Recombinant Hypocrea jecorina HFBI protein.
  • General notes

    Previously labelled as Hydrophobin-1. 

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab225992 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/5000.

Only tested with recombinant protein. No data available for endogenous protein.

Target

  • Relevance

    Contributes to surface hydrophobicity, which is important for processes such as association of hyphae in reproductive structures, dispersal of aerial spores and adhesion of pathogens to host structures.
  • Alternative names

    • hfb1 antibody
    • HFBI antibody
    • Hydrophobin I antibody
    • Hydrophobin-1 antibody
    • Hydrophobin1 antibody
    see all

Images

  • All lanes : Anti-HFBI antibody (ab225992) at 1/500 dilution

    Lane 1 : Recombinant Hypocrea jecorina HFBI protein 100 ng
    Lane 2 : Recombinant Hypocrea jecorina HFBI protein 50 ng
    Lane 3 : Recombinant Hypocrea jecorina HFBI protein 25 ng
    Lane 4 : Recombinant Hypocrea jecorina HFBI protein 12.5 ng

    Developed using the ECL technique.

References

ab225992 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225992.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up