Overview

  • Product name
  • Description
    Rabbit polyclonal to HFE
  • Host species
    Rabbit
  • Tested applications
    Suitable for: IHC-P, ICC/IF, WBmore details
  • Species reactivity
    Reacts with: Mouse, Rat, Human
    Predicted to work with: Chimpanzee
  • Immunogen

    Recombinant full length protein corresponding to Human HFE aa 1-348.
    Sequence:

    MGPRARPALLLLMLLQTAVLQGRLLRSHSLHYLFMGASEQDLGLSLFEAL GYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWLQLSQSLKGWDHMFTV DFWTIMENHNHSKESHTLQVILGCEMQEDNSTEGYWKYGYDGQDHLEFCP DTLDWRAAEPRAWPTKLEWERHKIRARQNRAYLERDCPAQLQQLLELGRG VLDQQVPPLVKVTHHVTSSVTTLRCRALNYYPQNITMKWLKDKQPMDAKE FEPKDVLPNGDGTYQGWITLAVPPGEEQRYTCQVEHPGLDQPLIVIWEPS PSGTLVIGVISGIAVFVVILFIGILFIILRKRQGSRGAMGHYVLAERE


    Database link: Q30201

  • Positive control
    • A375, HeLa and Caco-2 cell lysates.

Properties

Applications

Our Abpromise guarantee covers the use of ab176123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/50 - 1/200.

ab171870 - Rabbit polyclonal IgG, is suitable for use as an isotype control with this antibody.

ICC/IF Use at an assay dependent concentration.
WB 1/500 - 1/2000. Predicted molecular weight: 40 kDa.

Target

  • Function
    Binds to transferrin receptor (TFR) and reduces its affinity for iron-loaded transferrin.
  • Tissue specificity
    Expressed in all tissues tested except brain.
  • Involvement in disease
    Defects in HFE are a cause of hemochromatosis (HFE) [MIM:235200]. A disorder of iron metabolism characterized by iron overload. Excess iron is deposited in a variety of organs leading to their failure, and resulting in serious illnesses including cirrhosis, hepatomas, diabetes, cardiomyopathy, arthritis, and hypogonadotropic hypogonadism. Severe effects of the disease usually do not appear until after decades of progressive iron loading.
    Defects in HFE are associated with variegate porphyria (VP) [MIM:176200]. Porphyrias are inherited defects in the biosynthesis of heme, resulting in the accumulation and increased excretion of porphyrins or porphyrin precursors. They are classified as erythropoietic or hepatic, depending on whether the enzyme deficiency occurs in red blood cells or in the liver. VP is the most common form of porphyria in South Africa. It is characterized by skin hyperpigmentation and hypertrichosis, abdominal pain, tachycardia, hypertension and neuromuscular disturbances. High fecal levels of protoporphyrin and coproporphyrin, increased urine uroporphyrins and iron overload are typical markers of the disease. Note=Iron overload due to HFE mutations is a precipitating or exacerbating factor in variegate porphyria.
    Defects in HFE are associated with susceptibility to microvascular complications of diabetes type 7 (MVCD7) [MIM:612635]. These are pathological conditions that develop in numerous tissues and organs as a consequence of diabetes mellitus. They include diabetic retinopathy, diabetic nephropathy leading to end-stage renal disease, and diabetic neuropathy. Diabetic retinopathy remains the major cause of new-onset blindness among diabetic adults. It is characterized by vascular permeability and increased tissue ischemia and angiogenesis.
  • Sequence similarities
    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt
  • Database links
  • Alternative names
    • dJ221C16.10.1 antibody
    • Hemochromatosis antibody
    • Hemochromatosis protein antibody
    • Hereditary hemochromatosis protein antibody
    • Hereditary hemochromatosis protein HLA H antibody
    • HFE 1 antibody
    • HFE antibody
    • HFE_HUMAN antibody
    • HFE1 antibody
    • HH antibody
    • High Fe antibody
    • HLA H antibody
    • HLA-H antibody
    • HLAH antibody
    • MGC:150812 antibody
    • MGC10379 antibody
    • MGC103790 antibody
    • MHC class I like protein HFE antibody
    • MVCD7 antibody
    • TFQTL2 antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human esophagus tissue labelling HFE with ab176123 at 1/100. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of MCF7 cells using ab176123. Blue DAPI for nuclear staining.
  • All lanes : Anti-HFE antibody (ab176123) at 1/500 dilution

    Lane 1 : HeLa cell lysate
    Lane 2 : A375 cell lysate
    Lane 3 : Caco-2 cell lysate

    Predicted band size: 40 kDa

References

ab176123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab176123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up