Overview

  • Product name

  • Description

    Rabbit polyclonal to HGD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Orangutan
  • Immunogen

    Recombinant fragment corresponding to Human HGD aa 226-445.
    Sequence:

    DFLIPIAWYEDRQVPGGYTVINKYQGKLFAAKQDVSPFNVVAWHGNYTPY KYNLKNFMVINSVAFDHADPSIFTVLTAKSVRPGVAIADFVIFPPRWGVA DKTFRPPYYHRNCMSEFMGLIRGHYEAKQGGFLPGGGSLHSTMTPHGPDA DCFEKASKVKLAPERIADGTMAFMFESSLSLAVTKWGLKASRCLDENYHK CWEPLKSHFTPNSRNPAEPN


    Database link: Q93099

  • Positive control

    • WB: HeLa and HEK-293T whole cell lysate. IHC-P: Human liver and kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab225926 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 50 kDa (predicted molecular weight: 50 kDa).

Target

  • Tissue specificity

    Highest expression in the prostate, small intestine, colon, kidney and liver.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6.
  • Involvement in disease

    Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis.
  • Sequence similarities

    Belongs to the homogentisate dioxygenase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-dioxygenase antibody
    • AKU antibody
    • FLJ94126 antibody
    • hgd antibody
    • HGD_HUMAN antibody
    • HGO antibody
    • Homogentisate 1 2 dioxygenase antibody
    • Homogentisate 1 antibody
    • Homogentisate oxidase antibody
    • Homogentisate oxygenase antibody
    • Homogentisic acid oxidase antibody
    • Homogentisicase antibody
    see all

Images

  • All lanes : Anti-HGD antibody (ab225926) at 1/1000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) whole cell lysate

    Secondary
    All lanes : Goat polyclonal to Rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 50 kDa
    Observed band size: 50 kDa

  • Paraffin embedded human liver tissue stained for HGD with ab225926 (1/100 dilution) in immunohistochemical analysis.

  • Paraffin embedded human kidney tissue stained for HGD with ab225926 (1/100 dilution) in immunohistochemical analysis.

References

ab225926 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab225926.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up