Anti-HGD antibody (ab231953)
Key features and details
- Rabbit polyclonal to HGD
- Suitable for: IHC-P, WB
- Reacts with: Human, Pig
- Isotype: IgG
Overview
-
Product name
Anti-HGD antibody
See all HGD primary antibodies -
Description
Rabbit polyclonal to HGD -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Mouse, Orangutan -
Immunogen
Recombinant fragment (His-tag) corresponding to Human HGD aa 8-205. (Expressed in E.coli).
Sequence:SGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNK RSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQ KKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIV PQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYG
Database link: Q93099 -
Positive control
- WB: Pig liver lysate; Recombinant human HGD protein. IHC-P: Human kidney tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.40
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231953 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | Use a concentration of 5 - 20 µg/ml. | |
WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Tissue specificity
Highest expression in the prostate, small intestine, colon, kidney and liver. -
Pathway
Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6. -
Involvement in disease
Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis. -
Sequence similarities
Belongs to the homogentisate dioxygenase family. - Information by UniProt
-
Database links
- Entrez Gene: 3081 Human
- Entrez Gene: 15233 Mouse
- Entrez Gene: 100171592 Orangutan
- Omim: 607474 Human
- SwissProt: Q93099 Human
- SwissProt: O09173 Mouse
- SwissProt: Q5RF05 Orangutan
- Unigene: 368254 Human
see all -
Alternative names
- 2-dioxygenase antibody
- AKU antibody
- FLJ94126 antibody
see all
Images
-
Formalin-fixed, paraffin-embedded human kidney tissue stained for HGD using ab231953 at 20 µg/mL in immunohistochemical analysis. DAB staining.
-
Anti-HGD antibody (ab231953) at 2 µg/ml + Pig liver lysate.
-
Anti-HGD antibody (ab231953) at 2 µg/ml + Recombinant human HGD protein.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab231953 has not yet been referenced specifically in any publications.