Anti-HGD antibody (ab231953)
- Datasheet
- References
- Protocols
Overview
-
Product name
Anti-HGD antibody
See all HGD primary antibodies -
Description
Rabbit polyclonal to HGD -
Host species
Rabbit -
Tested applications
Suitable for: IHC-P, WBmore details -
Species reactivity
Reacts with: Human, Pig
Predicted to work with: Mouse, Orangutan
-
Immunogen
Recombinant fragment (His-tag) corresponding to Human HGD aa 8-205. (Expressed in E.coli).
Sequence:SGFGNECSSEDPRCPGSLPEGQNNPQVCPYNLYAEQLSGSAFTCPRSTNK RSWLYRILPSVSHKPFESIDEGQVTHNWDEVDPDPNQLRWKPFEIPKASQ KKVDFVSGLHTLCGAGDIKSNNGLAIHIFLCNTSMENRCFYNSDGDFLIV PQKGNLLIYTEFGKMLVQPNEICVIQRGMRFSIDVFEETRGYILEVYG
Database link: Q93099 -
Positive control
- WB: Pig liver lysate; Recombinant human HGD protein. IHC-P: Human kidney tissue.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.4
Preservative: 0.02% Sodium azide
Constituents: PBS, 50% Glycerol -
Concentration information loading... -
Purity
Immunogen affinity purified -
Purification notes
Antigen-specific affinity chromatography followed by Protein A affinity chromatography. -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
-
Recombinant Protein
Applications
Our Abpromise guarantee covers the use of ab231953 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
| Application | Abreviews | Notes |
|---|---|---|
| IHC-P | Use a concentration of 5 - 20 µg/ml. | |
| WB | Use a concentration of 0.2 - 2 µg/ml. |
Target
-
Tissue specificity
Highest expression in the prostate, small intestine, colon, kidney and liver. -
Pathway
Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6. -
Involvement in disease
Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis. -
Sequence similarities
Belongs to the homogentisate dioxygenase family. - Information by UniProt
-
Database links
- Entrez Gene: 3081 Human
- Entrez Gene: 15233 Mouse
- Entrez Gene: 100171592 Orangutan
- Omim: 607474 Human
- SwissProt: Q93099 Human
- SwissProt: O09173 Mouse
- SwissProt: Q5RF05 Orangutan
- Unigene: 368254 Human
see all -
Alternative names
- 2-dioxygenase antibody
- AKU antibody
- FLJ94126 antibody
see all
Images
-
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) - Anti-HGD antibody (ab231953)Formalin-fixed, paraffin-embedded human kidney tissue stained for HGD using ab231953 at 20 µg/mL in immunohistochemical analysis. DAB staining.
-
Western blot - Anti-HGD antibody (ab231953)Anti-HGD antibody (ab231953) at 2 µg/ml + Pig liver lysate. -
Western blot - Anti-HGD antibody (ab231953)Anti-HGD antibody (ab231953) at 2 µg/ml + Recombinant human HGD protein.
Datasheets and documents
References
ab231953 has not yet been referenced specifically in any publications.
