Overview

  • Product name

  • Description

    Rabbit polyclonal to HGD
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Mouse, Rat
    Predicted to work with: Human, Orangutan
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Mouse HGD aa 190-429. (Expressed in E.coli)
    Sequence:

    VDVFEETRGYILEVYGVHFELPDLGPIGANGLANPRDFLIPVAWYEDRRV PGGYTVINKFQGKLFACKQDVSPFNVVAWHGNYTPYKYNLENFMVINAVA FDHADPSIFTVLTAKSLRPGVAIADFVIFPPRWGVADKTFRPPYYHRNCM SEFMGLIKGHYEAKQGGFLPGGGSLHSAMTPHGPDADCFEKASKAKLEPE RIADGTMAFMFESSLSLAVTKWGLKTCSCLDENYYKCWEP


    Database link: O09173

  • Positive control

    • WB: Recombinant mouse HGD protein; Mouse and rat liver lysates. IHC-P: Mouse kidney and liver tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab231968 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab231968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 50 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Tissue specificity

    Highest expression in the prostate, small intestine, colon, kidney and liver.
  • Pathway

    Amino-acid degradation; L-phenylalanine degradation; acetoacetate and fumarate from L-phenylalanine: step 4/6.
  • Involvement in disease

    Defects in HGD are the cause of alkaptonuria (AKU) [MIM:203500]. AKU is an autosomal recessive error of metabolism characterized by an increase in the level of homogentisic acid. The clinical manifestations of AKU are urine that turns dark on standing and alkalinization, black ochronotic pigmentation of cartilage and collagenous tissues, and spine arthritis.
  • Sequence similarities

    Belongs to the homogentisate dioxygenase family.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2-dioxygenase antibody
    • AKU antibody
    • FLJ94126 antibody
    • hgd antibody
    • HGD_HUMAN antibody
    • HGO antibody
    • Homogentisate 1 2 dioxygenase antibody
    • Homogentisate 1 antibody
    • Homogentisate oxidase antibody
    • Homogentisate oxygenase antibody
    • Homogentisic acid oxidase antibody
    • Homogentisicase antibody
    see all

Images

  • Paraffin-embedded mouse liver tissue stained for HGD using ab231968 at 20 µg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded mouse kidney tissue stained for HGD using ab231968 at 20 µg/ml in immunohistochemical analysis. DAB staining.

     

  • All lanes : Anti-HGD antibody (ab231968) at 3 µg/ml

    Lane 1 : Mouse liver lysate
    Lane 2 : Rat liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-rabbit at 1/2000 dilution

    Predicted band size: 50 kDa

  • Anti-HGD antibody (ab231968) at 3 µg/ml + Recombinant mouse HGD protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 50 kDa

References

ab231968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab231968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up