Overview

  • Product name

  • Description

    Rabbit polyclonal to HGF
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Rat
    Predicted to work with: Mouse, Human
  • Immunogen

    Synthetic peptide aa 210-260 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary. from Isoform 3
    Sequence:

    NGESYRGLMDHTESGKICQRWDHQTPHRHKFLPERYPDKGFDDNYCRNPD G


    Database link: P14210-3

  • Positive control

    • Rat kidney tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab216623 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/100 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Potent mitogen for mature parenchymal hepatocyte cells, seems to be a hepatotrophic factor, and acts as a growth factor for a broad spectrum of tissues and cell types. Activating ligand for the receptor tyrosine kinase MET by binding to it and promoting its dimerization.
  • Involvement in disease

    Deafness, autosomal recessive, 39
  • Sequence similarities

    Belongs to the peptidase S1 family. Plasminogen subfamily.
    Contains 4 kringle domains.
    Contains 1 PAN domain.
    Contains 1 peptidase S1 domain.
  • Information by UniProt
  • Database links

  • Alternative names

    • DFNB39 antibody
    • F TCF antibody
    • Fibroblast derived tumor cytotoxic factor antibody
    • Hepatocyte growth factor (hepapoietin A; scatter factor) antibody
    • Hepatocyte growth factor antibody
    • Hepatocyte growth factor beta chain antibody
    • Hepatocyte growth factor precursor antibody
    • Hepatopoietin A antibody
    • Hepatopoietin-A antibody
    • Hgf antibody
    • HGF_HUMAN antibody
    • HGFB antibody
    • HPTA antibody
    • Lung fibroblast derived mitogen antibody
    • OTTHUMP00000161349 antibody
    • OTTHUMP00000206710 antibody
    • OTTHUMP00000206711 antibody
    • OTTHUMP00000206712 antibody
    • OTTHUMP00000206713 antibody
    • OTTHUMP00000206730 antibody
    • Scatter factor antibody
    • SF antibody
    see all

Images

  • Immunohistochemical analysis of formalin-fixed paraffin-embedded rat kidney tissue, labeling HGF using ab216623 at a 1/200 dilution, followed by conjugation to the secondary antibody and DAB staining.

References

ab216623 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab216623.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up