Overview

  • Product name

    Anti-HGFA Inhibitor 2 antibody
    See all HGFA Inhibitor 2 primary antibodies
  • Description

    Rabbit polyclonal to HGFA Inhibitor 2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to HGFA Inhibitor 2 aa 28-197. Two N-terminal tags, His-tag and GST-tag. (Expressed in E.coli).
    Sequence:

    ADRERSIHDFCLVSKVVGRCRASMPRWWYNVTDGSCQLFVYGGCDGNSNN YLTKEECLKKCATVTENATGDLATSRNAADSSVPSAPRRQDSEDHSSDMF NYEEYCTANAVTGPCRASFPRWYFDVERNSCNNFIYGGCRGNKNSYRSEE ACMLRCFRQQENPPLPLGSK


    Database link: O43291

  • Positive control

    • IHC-P: Human kidney and liver tissue. WB: Recombinant human HGFA Inhibitor 2 protein; PC-3 cell lysate; Rat testis lysate.

Properties

Applications

Our Abpromise guarantee covers the use of ab233203 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 28 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Inhibitor of HGF activator. Also inhibits plasmin, plasma and tissue kallikrein, and factor XIa.
  • Tissue specificity

    Expressed in placenta, kidney, pancreas, prostate, testis, thymus, and trachea.
  • Involvement in disease

    Defects in SPINT2 are the cause of diarrhea type 3 (DIAR3) [MIM:270420]; also known as congenital sodium diarrhea (CSD). DIAR3 is a rare, inherited diarrhea of infancy. A diagnosis of DIAR3 is made on the findings of a life-threatening secretory diarrhea, severe metabolic acidosis, and hyponatremia secondary to extraordinarily high fecal losses of sodium, with low or normal excretion of urinary sodium, in the absence of infectious, autoimmune, and endocrine causes.
  • Sequence similarities

    Contains 2 BPTI/Kunitz inhibitor domains.
  • Domain

    This inhibitor contains two inhibitory domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • AL024025 antibody
    • Bikunin, placental antibody
    • C76321 antibody
    • DIAR3 antibody
    • FLJ45571 antibody
    • HAI-2 antibody
    • HAI2 antibody
    • Hepatocyte growth factor activator inhibitor type 2 antibody
    • Kop antibody
    • Kunitz type protease inhibitor 2 antibody
    • Kunitz-type protease inhibitor 2 antibody
    • Kunitz-type serine protease inhibitor antibody
    • MGC72638 antibody
    • PB antibody
    • Placental bikunin antibody
    • Serine peptidase inhibitor Kunitz type 2 antibody
    • Serine protease inhibitor, Kunitz type, 2 antibody
    • SPINT2 antibody
    • SPIT2_HUMAN antibody
    see all

Images

  • All lanes : Anti-HGFA Inhibitor 2 antibody (ab233203) at 1 µg/ml

    Lane 1 : PC-3 (human prostate adenocarcinoma cell line) cell lysate.
    Lane 2 : Rat testis tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 28 kDa

  • Anti-HGFA Inhibitor 2 antibody (ab233203) at 2 µg/ml + Recombinant human HGFA Inhibitor 2 protein.

    Predicted band size: 28 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HGFA Inhibitor 2 using ab233203 at 20ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for HGFA Inhibitor 2 using ab233203 at 20ug/ml in immunohistochemical analysis. DAB staining.

References

ab233203 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233203.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up