Overview

  • Product name

  • Description

    Rabbit polyclonal to Hhip
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human Hhip aa 18-220.
    Sequence:

    FFEGDAKFGERNEGSGARRRRCLNGNPPKRLKRRDRRMMSQLELLSGGEM LCGGFYPRLSCCLRSDSPGLGRLENKIFSVTNNTECGKLLEEIKCALCSP HSQSLFHSPEREVLERDLVLPLLCKDYCKEFFYTCRGHIPGFLQTTADEF CFYYARKDGGLCFPDFPRKQVRGPASNYLDQMEEYDKVEEISRKHKHNCF CIQ


    Database link: Q96QV1

  • Positive control

    • WB: Rat heart tissue lysate. IHC-P: Human testis and brain tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab230271 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/1000 - 1/5000. Detects a band of approximately 79 kDa (predicted molecular weight: 79, 36 kDa).

Target

  • Function

    Modulates hedgehog signaling in several cell types including brain and lung through direct interaction with members of the hedgehog family.
  • Tissue specificity

    Widely expressed in fetal and adult tissues. Highest expression in adult heart, liver and pancreas, and in fetal kidney.
  • Sequence similarities

    Belongs to the HHIP family.
    Contains 2 EGF-like domains.
  • Domain

    A flexible loop interacts with the SHH zinc binding site and contributes to zinc binding.
  • Cellular localization

    Cytoplasm and Cell membrane. Secreted. The last 22 C-terminal amino acids may participate in cell membrane attachment.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ20992 antibody
    • FLJ90230 antibody
    • Hedgehog interacting protein antibody
    • Hedgehog-interacting protein antibody
    • hedgehoginteracting protein antibody
    • HHIP antibody
    • HHIP_HUMAN antibody
    • Hip antibody
    see all

Images

  • Anti-Hhip antibody (ab230271) at 1/1000 dilution + Rat heart tissue lysate

    Secondary
    Goat polyclonal to rabbit IgG at 1/10000 dilution

    Developed using the ECL technique.

    Predicted band size: 79, 36 kDa
    Observed band size: 79 kDa
    why is the actual band size different from the predicted?

  • Paraffin-embedded human testis tissue stained for Hhip with ab230271 at 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human brain tissue stained for Hhip with ab230271 at 1/100 dilution in immunohistochemical analysis.

References

ab230271 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab230271.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up