Overview

  • Product name

  • Description

    Rabbit Polyclonal to HHLA2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Synthetic peptide within Human HHLA2 aa 270-315 conjugated to keyhole limpet haemocyanin. The exact sequence is proprietary.
    Sequence:

    VLAYYLSSSQNTIINESRFSWNKELINQSDFSMNLMDLNLSDSGEY


    Database link: Q9UM44

  • Positive control

    • Human rectal carcinoma tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.09% Sodium azide
    Constituents: 1% BSA, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab214327 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500.
IHC-P 1/100 - 1/500.

Target

  • Tissue specificity

    Expressed in colon, small intestine, lung and kidney.
  • Sequence similarities

    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
    Contains 2 Ig-like V-type (immunoglobulin-like) domains.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • B7H7 antibody
    • HERV H LTR associating 2 antibody
    • HERV-H LTR-associating protein 2 antibody
    • HHLA 2 antibody
    • HHLA2 antibody
    • HHLA2_HUMAN antibody
    • Human endogenous retrovirus H long terminal repeat associating protein 2 antibody
    • Human endogenous retrovirus-H long terminal repeat-associating protein 2 antibody
    see all

Images

  • All lanes : Anti-HHLA2 antibody (ab214327) at 1/500 dilution

    Lane 1 : Lovo cell lysates
    Lane 2 : A549 cell lysates

    Secondary
    All lanes : Conjugated secondary antibody at 1/20000 dilution
  • Immunohistochemical analysis of formalin-fixed, paraffin-embedded human rectal carcinoma tissue labeling HHLA2 with ab214327 at 1/200 dilution followed by conjugation to the secondary antibody and DAB staining.

References

This product has been referenced in:

  • Lin G  et al. Immune Checkpoint Human Endogenous Retrovirus-H Long Terminal Repeat-Associating Protein 2 is Upregulated and Independently Predicts Unfavorable Prognosis in Bladder Urothelial Carcinoma. Nephron 141:256-264 (2019). Read more (PubMed: 30602154) »
  • Zhu Z & Dong W Overexpression of HHLA2, a member of the B7 family, is associated with worse survival in human colorectal carcinoma. Onco Targets Ther 11:1563-1570 (2018). Read more (PubMed: 29593422) »
See all 3 Publications for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab214327.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up