Overview

  • Product name

    Anti-hHR23A antibody [1E4D6]
    See all hHR23A primary antibodies
  • Description

    Mouse monoclonal [1E4D6] to hHR23A
  • Host species

    Mouse
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human hHR23A aa 1-363. (Expressed in E.coli).
    Sequence:

    MAVTITLKTLQQQTFKIRMEPDETVKVLKEKIEAEKGRDAFPVAGQKLIY AGKILSDDVPIRDYRIDEKNFVVVMVTKTKAGQGTSAPPEASPTAAPESS TSFPPAPTSGMSHPPPAAREDKSPSEESAPTTSPESVSGSVPSSGSSGRE EDAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT GIPGSPEPEHGSVQESQVSEQPATEAAGENPLEFLRDQPQFQNMRQVIQQ NPALLPALLQQLGQENPQLLQQISRHQEQFIQMLNEPPGELADISDVEGE VGAIGEEAPQMNYIQVTPQEKEAIERLKALGFPESLVIQAYFACEKNENL AANFLLSQNF DDE


    Database link: P54725

  • Positive control

    • WB: Recombinant human hHR32A (aa 1-363) protein; hHR23A (aa 1-363)-hIgG-Fc-transfected HEK-293 cell lysate.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    Preservative: 0.05% Sodium azide
    Constituent: PBS
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    Purified from tissue culture supernatant.
  • Clonality

    Monoclonal
  • Clone number

    1E4D6
  • Isotype

    IgG2b
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab233795 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000.

Target

  • Function

    Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to 'Lys-48'-linked polyubiquitin chains in a length-dependent manner and with a lower affinity to 'Lys-63'-linked polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome.
    Involved in nucleotide excision repair and is thought to be functional equivalent for RAD23B in global genome nucleotide excision repair (GG-NER) by association with XPC. In vitro, the XPC:RAD23A dimer has NER activity. Can stabilize XPC.
    Involved in vpr-dependent replication of HIV-1 in non-proliferating cells and primary macrophages. Required for the association of HIV-1 vpr with the host proteasome.
  • Sequence similarities

    Belongs to the RAD23 family.
    Contains 2 UBA domains.
    Contains 1 ubiquitin-like domain.
  • Domain

    The ubiquitin-like domain mediates interaction with ATXN3.
    The ubiquitin-like (UBL) and the UBA (ubiquitin-associated) domains interact intramolecularly in a highly dynamic manner, as each UBA domain competes for an overlapping UBL domain surface. Binding of ubiquitin or proteasome subunit PSMD4 disrupt the UBL-UBA domain interactions and drive RAD23A in to an open conformation.
  • Post-translational
    modifications

    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • hHR 23A antibody
    • hHR23A antibody
    • HR23A antibody
    • MGC111083 antibody
    • RAD 23a antibody
    • RAD23 homolog A (S. cerevisiae) antibody
    • RAD23 homolog A antibody
    • RAD23 yeast homolog A antibody
    • RAD23A antibody
    • RD23A_HUMAN antibody
    • UV excision repair protein RAD23 antibody
    • UV excision repair protein RAD23 homolog A antibody
    see all

Images

  • Anti-hHR23A antibody [1E4D6] (ab233795) at 1/500 dilution + Recombinant human hH23A (aa 1-363) protein


    Expected MW is 43 kDa.

  • All lanes : Anti-hHR23A antibody [1E4D6] (ab233795) at 1/500 dilution

    Lane 1 : Untransfected HEK-293 (human epithelial cell line from embryonic kidney) cell lysate
    Lane 2 : hHR23A (aa 1-363)-hIgG-Fc-transfected HEK-293 cell lysate.

References

ab233795 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233795.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up