Overview

  • Product name

  • Description

    Rabbit polyclonal to hHR23b
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human hHR23b aa 207-296.
    Sequence:

    VIEALRASFNNPDRAVEYLLMGIPGDRESQAVVDPPQAASTGAPQSSAVA AAAATTTATTTTTSSGGHPLEFLRNQPQFQQMRQIIQQNP


    Database link: P54727

  • Positive control

    • WB: HEK-293T over-expression cell lysate. IHC-P: Human stomach tissue. ICC/IF: A431 cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab223776 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/100 - 1/250. Predicted molecular weight: 43 kDa.
IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

Target

  • Function

    Multiubiquitin chain receptor involved in modulation of proteasomal degradation. Binds to polyubiquitin chains. Proposed to be capable to bind simultaneously to the 26S proteasome and to polyubiquitinated substrates and to deliver ubiquitinated proteins to the proteasome. May play a role in endoplasmatic reticulum-associated degradation (ERAD) of misfolded glycoproteins by association with PNGase and delivering deglycosylated proteins to the proteasome.
    Involved in global genome nucleotide excision repair (GG-NER) by acting as component of the XPC complex. Cooperatively with CETN2 appears to stabilize XPC. May protect XPC from proteasomal degradation.
    The XPC complex is proposed to represent the first factor bound at the sites of DNA damage and together with other core recognition factors, XPA, RPA and the TFIIH complex, is part of the pre-incision (or initial recognition) complex. The XPC complex recognizes a wide spectrum of damaged DNA characterized by distortions of the DNA helix such as single-stranded loops, mismatched bubbles or single stranded overhangs. The orientation of XPC complex binding appears to be crucial for inducing a productive NER. XPC complex is proposed to recognize and to interact with unpaired bases on the undamaged DNA strand which is followed by recruitment of the TFIIH complex and subsequent scanning for lesions in the opposite strand in a 5'-to-3' direction by the NER machinery. Cyclobutane pyrimidine dimers (CPDs) which are formed upon UV-induced DNA damage esacpe detection by the XPC complex due to a low degree of structural perurbation. Instead they are detected by the UV-DDB complex which in turn recruits and cooperates with the XPC complex in the respective DNA repair. In vitro, the XPC:RAD23B dimer is sufficient to initiate NER; it preferentially binds to cisplatin and UV-damaged double-stranded DNA and also binds to a variety of chemically and structurally diverse DNA adducts. XPC:RAD23B contacts DNA both 5' and 3' of a cisplatin lesion with a preference for the 5' side. XPC:RAD23B induces a bend in DNA upon binding. XPC:RAD23B stimulates the activity of DNA glycosylases TDG and SMUG1.
  • Sequence similarities

    Belongs to the RAD23 family.
    Contains 1 STI1 domain.
    Contains 2 UBA domains.
    Contains 1 ubiquitin-like domain.
  • Domain

    The ubiquitin-like domain mediates interaction with ATXN3.
  • Cellular localization

    Nucleus. Cytoplasm. The intracellular distribution is cell cycle dependent. Localized to the nucleus and the cytoplasm during G1 phase. Nuclear levels decrease during S-phase; upon entering mitosis, relocalizes in the cytoplasm without association with chromatin.
  • Information by UniProt
  • Database links

  • Alternative names

    • hHR 23b antibody
    • hHR23B antibody
    • HR 23B antibody
    • HR23B antibody
    • mHR 23B antibody
    • mHR23B antibody
    • p58 antibody
    • RAD 23B antibody
    • RAD23 (S. cerevisiae) homolog B antibody
    • RAD23 homolog B (S. cerevisiae) antibody
    • RAD23 homolog B antibody
    • RAD23 yeast homolog of B antibody
    • Rad23b antibody
    • RD23B_HUMAN antibody
    • UV excision repair protein RAD23 homolog B antibody
    • XP C repair complementing complex 58 kDa antibody
    • XP C repair complementing complex 58 kDa protein antibody
    • XP C repair complementing protein antibody
    • XP-C repair-complementing complex 58 kDa protein antibody
    • XPC repair complementing complex 58 kDa antibody
    • XPC repair complementing complex 58 kDa protein antibody
    • XPC repair complementing protein antibody
    see all

Images

  • Paraffin-embedded human stomach tissue stained for hHR23b using ab223776 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-hHR23b antibody (ab223776) at 1/100 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate, vector only negative control
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) over-expressing C-terminally myc-DDK tagged hHR23b cell lysate

    Predicted band size: 43 kDa

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for hHR23b (green) using ab223776 at 4 µg/ml in ICC/IF.

  • Paraffin-embedded human kidney tissue stained for hHR23b using ab223776 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human testis tissue stained for hHR23b using ab223776 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for hHR23b using ab223776 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon tissue stained for hHR23b using ab223776 at 1/50 dilution in immunohistochemical analysis.

  • Anti-hHR23b antibody (ab223776) at 1/100 dilution + RH-30 cell lysate

    Predicted band size: 43 kDa

References

ab223776 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab223776.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up