Overview

  • Product name

  • Description

    Rabbit polyclonal to HIC1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment corresponding to Human HIC1 aa 297-418.
    Sequence:

    LEEAAPPSDPFRGGSGSPGPEPPGRPDGPSLLYRWMKHEPGLGSYGDELG RERGSPSERCEERGGDAAVSPGGPPLGLAPPPRYPGSLDGPGAGGDGDDY KSSSEETGSSEDPSPPGGHLEG


    Database link: Q14526

  • Positive control

    • IHC-P: Human endometrial cancer and breast cancer tissue.

Properties

Applications

Our Abpromise guarantee covers the use of ab235037 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/200 - 1/500.

Target

  • Function

    Transcriptional repressor. May act as a tumor suppressor. May be involved in development of head, face, limbs and ventral body wall.
  • Tissue specificity

    Ubiquitously expressed with highest levels found in lung, colon, prostate, thymus, testis and ovary. Expression is absent or decreased in many tumor cells.
  • Sequence similarities

    Belongs to the krueppel C2H2-type zinc-finger protein family. Hic subfamily.
    Contains 1 BTB (POZ) domain.
    Contains 5 C2H2-type zinc fingers.
  • Post-translational
    modifications

    Acetylated on several residues, including Lys-333. Lys-333 is deacetylated by SIRT1.
    Sumoylated on Lys-333 by a PIAS family member, which positively regulates transcriptional repression ativity and is enhanced by HDAC4.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • Hic 1 antibody
    • HIC ZBTB transcriptional repressor 1 antibody
    • Hic-1 antibody
    • Hic1 antibody
    • HIC1_HUMAN antibody
    • Hypermethylated in cancer 1 antibody
    • Hypermethylated in cancer 1 protein antibody
    • ZBTB29 antibody
    • Zinc finger and BTB domain-containing protein 29 antibody
    • ZNF901 antibody
    see all

Images

  • Paraffin-embedded human endometrial cancer tissue stained for HIC1 using ab235037 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

  • Paraffin-embedded human breast cancer tissue stained for HIC1 using ab235037 at 1/400 dilution in immunohistochemical analysis.

    After dewaxing and hydration, antigen retrieval was mediated by high pressure in a citrate buffer (pH 6.0). Section was blocked with 10% normal goat serum for 30 minutes at room temperature. Then primary antibody (1% BSA) was incubated at 4°C overnight. The primary is detected by a biotinylated secondary antibody and visualized using an HRP conjugated SP system.

References

ab235037 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab235037.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up