Anti-HIF-2-alpha antibody [OTI2G5] (ab157249)
Key features and details
- Mouse monoclonal [OTI2G5] to HIF-2-alpha
- Suitable for: WB
- Knockout validated
- Reacts with: Human
- Isotype: IgG1
Get better batch-to-batch reproducibility with a recombinant antibody
- Research with confidence – consistent and reproducible results with every batch
- Long-term and scalable supply – powered by recombinant technology for fast production
- Success from the first experiment – confirmed specificity through extensive validation
- Ethical standards compliant – production is animal-free
Overview
-
Product name
Anti-HIF-2-alpha antibody [OTI2G5]
See all HIF-2-alpha primary antibodies -
Description
Mouse monoclonal [OTI2G5] to HIF-2-alpha -
Host species
Mouse -
Tested applications
Suitable for: WBmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human HIF-2-alpha aa 584-870.
Sequence:LLDKFQQQLESKKTEPEHRPMSSIFFDAGSKASLPPCCGQASTPLSSMGG RSNTQWPPDPPLHFGPTKWAVGDQRTEFLGAAPLGPPVSPPHVSTFKTRS AKGFGARGPDVLSPAMVALSNKLKLKRQLEYEEQAFQDLSGGDPPGGSTS HLMWKRMKNLRGGSCPLMPDKPLSANVPNDKFTQNPMRGLGHPLRHLPLP QPPSAISPGENSKSRFPPQCYATQYQDYSLSSAHKVSGMASRLLGPSFES YLLPELTRYDCEVNVPVLGSSTLLQGGDLLRALDQAT
-
Positive control
- HEK293T cells transfected with pCMV6-ENTRY HIF-2-alpha.
-
General notes
The clone number has been updated from 2G5 to OTI2G5, both clone numbers name the same clone.
The Life Science industry has been in the grips of a reproducibility crisis for a number of years. Abcam is leading the way in addressing this with our range of recombinant monoclonal antibodies and knockout edited cell lines for gold-standard validation. Please check that this product meets your needs before purchasing.
If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, along with publications, customer reviews and Q&As
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles. -
Storage buffer
pH: 7.30
Preservative: 0.02% Sodium azide
Constituents: 48% PBS, 50% Glycerol, 1% BSA -
Concentration information loading...
-
Purity
Protein G purified -
Purification notes
Purified from TCS -
Clonality
Monoclonal -
Clone number
OTI2G5 -
Isotype
IgG1 -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
The Abpromise guarantee
Our Abpromise guarantee covers the use of ab157249 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
WB | (1) |
1/2000. Predicted molecular weight: 96 kDa.
|
Notes |
---|
WB
1/2000. Predicted molecular weight: 96 kDa. |
Target
-
Function
Transcription factor involved in the induction of oxygen regulated genes. Binds to core DNA sequence 5'-[AG]CGTG-3' within the hypoxia response element (HRE) of target gene promoters. Regulates the vascular endothelial growth factor (VEGF) expression and seems to be implicated in the development of blood vessels and the tubular system of lung. May also play a role in the formation of the endothelium that gives rise to the blood brain barrier. Potent activator of the Tie-2 tyrosine kinase expression. Activation seems to require recruitment of transcriptional coactivators such as CREBPB and probably EP300. Interaction with redox regulatory protein APEX seems to activate CTAD. -
Tissue specificity
Expressed in most tissues, with highest levels in placenta, lung and heart. Selectively expressed in endothelial cells. -
Involvement in disease
Defects in EPAS1 are the cause of erythrocytosis familial type 4 (ECYT4) [MIM:611783]. ECYT4 is an autosomal dominant disorder characterized by increased serum red blood cell mass, elevated hemoglobin concentration and hematocrit, and normal platelet and leukocyte counts. -
Sequence similarities
Contains 1 basic helix-loop-helix (bHLH) domain.
Contains 1 PAC (PAS-associated C-terminal) domain.
Contains 2 PAS (PER-ARNT-SIM) domains. -
Post-translational
modificationsIn normoxia, is probably hydroxylated on Pro-405 and Pro-531 by EGLN1/PHD1, EGLN2/PHD2 and/or EGLN3/PHD3. The hydroxylated prolines promote interaction with VHL, initiating rapid ubiquitination and subsequent proteasomal degradation. Under hypoxia, proline hydroxylation is impaired and ubiquitination is attenuated, resulting in stabilization.
In normoxia, is hydroxylated on Asn-847 by HIF1AN thus probably abrogating interaction with CREBBP and EP300 and preventing transcriptional activation.
Phosphorylated on multiple sites in the CTAD.
The iron and 2-oxoglutarate dependent 3-hydroxylation of asparagine is (S) stereospecific within HIF CTAD domains. -
Cellular localization
Nucleus. - Information by UniProt
-
Database links
- Entrez Gene: 2034 Human
- Omim: 603349 Human
- SwissProt: Q99814 Human
- Unigene: 468410 Human
-
Alternative names
- Basic helix loop helix PAS protein MOP2 antibody
- Basic-helix-loop-helix-PAS protein MOP2 antibody
- bHLHe73 antibody
see all
Images
-
All lanes : Anti-HIF-2-alpha antibody [OTI2G5] (ab157249) at 1/500 dilution
Lane 1 : Wild-type A549 Untreated (DFO Control) cell lysate
Lane 2 : Wild-type A549 Treated DFO (1 mM, 24 h) cell lysate
Lane 3 : EPAS1 knockout A549 Untreated (DFO Control) cell lysate
Lane 4 : EPAS1 knockout A549 Treated DFO (1 mM, 24 h) cell lysate
Lysates/proteins at 20 µg per lane.
Performed under reducing conditions.
Predicted band size: 96 kDa
Observed band size: 100 kDa why is the actual band size different from the predicted?False colour image of Western blot: Anti-HIF-2-alpha antibody [OTI2G5] staining at 1/500 dilution, shown in black; Rabbit Anti-GAPDH antibody [EPR16891] (ab181602) loading control staining at 1/20000 dilution, shown in red. In Western blot, ab157249 was shown to bind specifically to HIF-2-alpha. A band was observed at 100 kDa in treated wild-type A549 cell lysates with no signal observed at this size in EPAS1 knockout cell line ab259774 (knockout cell lysate ab259779). To generate this image, wild-type and EPAS1 knockout A549 cell lysates were analysed. First, samples were run on an SDS-PAGE gel then transferred onto a nitrocellulose membrane. Membranes were blocked in 5 % BSA in TBS-0.1 % Tween® 20 (TBS-T) before incubation with primary antibodies overnight at 4 °C. Blots were washed four times in TBS-T, incubated with secondary antibodies for 1 h at room temperature, washed again four times before development with Optiblot (ECL reagent ab133456) and imaged with 20 seconds exposure time. Secondary antibodies used were HRP conjugated Goat anti-Mouse (H+L) and Goat anti-Rabbit IgG H&L (IRDye® 680RD) preabsorbed (ab216777) at 1/20000 dilution.
-
All lanes : Anti-HIF-2-alpha antibody [OTI2G5] (ab157249) at 1/2000 dilution
Lane 1 : HEK293T cells transfected with pCMV6-ENTRY control
Lane 2 : HEK293T cells transfected with pCMV6-ENTRY HIF2 alpha
Lysates/proteins at 5 µg per lane.
Predicted band size: 96 kDa
HEK293T cell lysates were generated from transient transfection of the cDNA clone (RC216194)
Datasheets and documents
-
Datasheet download
References (5)
ab157249 has been referenced in 5 publications.
- Hu L et al. TBK1 Is a Synthetic Lethal Target in Cancer with VHL Loss. Cancer Discov 10:460-475 (2020). PubMed: 31810986
- Hong K et al. USP37 promotes deubiquitination of HIF2a in kidney cancer. Proc Natl Acad Sci U S A N/A:N/A (2020). PubMed: 32461361
- Jiang L et al. Similarity in the functions of HIF-1a and HIF-2a proteins in cervical cancer cells. Oncol Lett 14:5643-5651 (2017). PubMed: 29098039
- Zecchini V et al. Nuclear ARRB1 induces pseudohypoxia and cellular metabolism reprogramming in prostate cancer. EMBO J 33:1365-82 (2014). WB, ICC/IF . PubMed: 24837709
- Brose SA et al. Fatty acid biosynthesis from glutamate and glutamine is specifically induced in neuronal cells under hypoxia. J Neurochem 129:400-12 (2014). PubMed: 24266789