Overview

  • Product name

  • Description

    Rabbit polyclonal to HIF1 beta
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, WBmore details
  • Species reactivity

    Reacts with: Rat, Human, Pig
    Predicted to work with: Cow
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HIF1 beta aa 624-789. (Expressed in E.coli).
    Sequence:

    QISRHSNPTQGATPTWTPTTRSGFSAQQVATQATAKTRTSQFGVGSFQTP SSFSSMSLPGAPTASPGAAAYPSLTNRGSNFAPETGQTAGQFQTRTAEGV GVWPQWQGQQPHHRSSSSEQHVQQPPAQQPGQPEVFQEMLSMLGDQSNSY NNEEFPDLTMFPPFSE


    Database link: P27540

  • Positive control

    • WB: Recombinant human HIF1 beta protein; Human serum; HepG2 cell lysate; Pig kidney lysate; Rat placenta lysate. ICC/IF: HepG2 cells.

Properties

Applications

Our Abpromise guarantee covers the use of ab232964 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 87 kDa.

Target

  • Function

    Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • arnT antibody
    • ARNT protein antibody
    • ARNT_HUMAN antibody
    • Aryl hydrocarbon receptor nuclear translocator antibody
    • bHLHe2 antibody
    • Class E basic helix-loop-helix protein 2 antibody
    • Dioxin receptor antibody
    • Dioxin receptor nuclear translocator antibody
    • Drnt antibody
    • HIF 1 beta antibody
    • HIF 1beta antibody
    • HIF-1-beta antibody
    • HIF1-beta antibody
    • HIF1B antibody
    • HIF1beta antibody
    • Hypoxia Inducible Factor 1 antibody
    • Hypoxia inducible factor 1 beta antibody
    • Hypoxia-inducible factor 1-beta antibody
    • nuclear translocator antibody
    • Tango antibody
    see all

Images

  • All lanes : Anti-HIF1 beta antibody (ab232964) at 2 µg/ml

    Lane 1 : Human serum
    Lane 2 : HepG2 (human liver hepatocellular carcinoma cell line) cell lysate
    Lane 3 : Pig kidney lysate
    Lane 4 : Rat placenta lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 87 kDa

  • Anti-HIF1 beta antibody (ab232964) at 2 µg/ml + Recombinant human HIF1 beta protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 87 kDa

  • HepG2 (human liver hepatocellular carcinoma cell line) cells labelling HIF1 beta (green) using ab232964 at 20 µg/ml in ICC/IF, followed by FITC staining.

References

ab232964 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232964.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up