Overview

  • Product name

    Anti-HIF1 beta antibody [OTI1A1]
    See all HIF1 beta primary antibodies
  • Description

    Mouse monoclonal [OTI1A1] to HIF1 beta
  • Host species

    Mouse
  • Tested applications

    Suitable for: WB, IHC-P, Flow Cyt, ICC/IFmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rabbit, Cow
  • Immunogen

    Recombinant full length protein corresponding to Human HIF1 beta aa 2-789. Produced in HEK-293T cells (NP_001659).
    Sequence:

    AATTANPEMTSDVPSLGPAIASGNSGPGIQGGGAIVQRAIKRRPGLDFDD DGEGNSKFLRCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRR RNKMTAYITELSDMVPTCSALARKPDKLTILRMAVSHMKSLRGTGNTSTD GSYKPSFLTDQELKHLILEAADGFLFIVSCETGRVVYVSDSVTPVLNQPQ SEWFGSTLYDQVHPDDVDKLREQLSTSENALTGRILDLKTGTVKKEGQQS SMRMCMGSRRSFICRMRCGSSSVDPVSVNRLSFVRNRCRNGLGSVKDGEP HFVVVHCTGYIKAWPPAGVSLPDDDPEAGQGSKFCLVAIGRLQVTSSPNC TDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQPQELLGKNIVEFCH PEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNQEWLWMRTSSFTFQNPYS DEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLAP RQQQQQTELDMVPGRDGLASYNHSQVVQPVTTTGPEHSKPLEKSDGLFAQ DRDPRFSEIYHNINADQSKGISSSTVPATQQLFSQGNTFPPTPRPAENFR NSGLAPPVTIVQPSASAGQMLAQISRHSNPTQGATPTWTPTTRSGFSAQQ VATQATAKTRTSQFGVGSFQTPSSFSSMSLPGAPTASPGAAAYPSLTNRG SNFAPETGQTAGQFQTRTAEGVGVWPQWQGQQPHHRSSSSEQHVQQPPAQ QPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPPFSE


    Database link: P27540

  • Positive control

    • WB: HEK-293T cell lysate transfected with or pCMV6-ENTRY HIF1 beta cDNA; Human testis, omentum, brain and ovary extracts. IHC-P: Human colon, colon adenocarcinoma, kidney, liver, ovary adenocarcinoma, pancreas, thyroid carcinoma, endometrium and prostate tissues. ICC/IF: COS-7 cells transiently transfected with pCMV6-ENTRY HIF1 beta. Flow Cyt: HEK-293T cells transfected Hif1 beta overexpress plasmid; Jurkat cells.
  • General notes

    Clone OTI1A1 (formerly 1A1).

Properties

Applications

Our Abpromise guarantee covers the use of ab123853 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 87 kDa.
IHC-P 1/50. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.
Flow Cyt 1/100.

 

 

ICC/IF 1/100.

Target

  • Function

    Required for activity of the Ah (dioxin) receptor. This protein is required for the ligand-binding subunit to translocate from the cytosol to the nucleus after ligand binding. The complex then initiates transcription of genes involved in the activation of PAH procarcinogens. The heterodimer with HIF1A or EPAS1/HIF2A functions as a transcriptional regulator of the adaptive response to hypoxia.
  • Sequence similarities

    Contains 1 basic helix-loop-helix (bHLH) domain.
    Contains 1 PAC (PAS-associated C-terminal) domain.
    Contains 2 PAS (PER-ARNT-SIM) domains.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • arnT antibody
    • ARNT protein antibody
    • ARNT_HUMAN antibody
    • Aryl hydrocarbon receptor nuclear translocator antibody
    • bHLHe2 antibody
    • Class E basic helix-loop-helix protein 2 antibody
    • Dioxin receptor antibody
    • Dioxin receptor nuclear translocator antibody
    • Drnt antibody
    • HIF 1 beta antibody
    • HIF 1beta antibody
    • HIF-1-beta antibody
    • HIF1-beta antibody
    • HIF1B antibody
    • HIF1beta antibody
    • Hypoxia Inducible Factor 1 antibody
    • Hypoxia inducible factor 1 beta antibody
    • Hypoxia-inducible factor 1-beta antibody
    • nuclear translocator antibody
    • Tango antibody
    see all

Images

  • All lanes : Anti-HIF1 beta antibody [OTI1A1] (ab123853) at 1/2000 dilution

    Lane 1 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate transfected with the pCMV6-ENTRY control cDNA
    Lane 2 : HEK-293T cell lysate transfected with or pCMV6-ENTRY HIF1 beta cDNA

    Lysates/proteins at 5 µg per lane.

    Predicted band size: 87 kDa

  • Paraffin-embedded human colon tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human colon adenocarcinoma tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human kidney tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human liver tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human ovary adenocarcinoma tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human pancreas tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human thyroid carcinoma tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • All lanes : Anti-HIF1 beta antibody [OTI1A1] (ab123853) at 1/500 dilution

    Lane 1 : Human testis extract
    Lane 2 : Human omentum extract
    Lane 3 : Human uterus extract
    Lane 4 : Human breast extract
    Lane 5 : Human brain extract
    Lane 6 : Human liver extract
    Lane 7 : Human ovary extract
    Lane 8 : Human thyroid gland extract
    Lane 9 : Human colon extract
    Lane 10 : Human spleen extract

    Lysates/proteins at 10 µg per lane.

    Predicted band size: 87 kDa

  • Paraffin-embedded human endometrium tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • Paraffin-embedded human prostate tissue stained for HIF1 beta using ab123853 at 1/50 dilution in immunohistochemical analysis.

  • COS-7 (african green monkey kidney fibroblast-like cell line) cells transiently transfected by pCMV6-ENTRY HIF1 beta stained for HIF1 beta (green) using ab123853 at 1/100 dilution in ICC/IF.

  • Flow cytometric analysis of HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cells transfected with either pCMV6-ENTRY HIF1 beta (Red) or empty vector control (Blue) labeling HIF1 beta with ab123853 at 1/100 dilution.

  • Flow cytometric analysis of Jurkat (human T cell leukemia cell line from peripheral blood) cells labeling HIF1 beta with ab123853 at 1/100 dilution (Red) compared to a nonspecific negative control antibody (Blue).

References

ab123853 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab123853.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up