Overview

  • Product name

    Anti-HIF1AN/FIH-1 antibody
    See all HIF1AN/FIH-1 primary antibodies
  • Description

    Rabbit polyclonal to HIF1AN/FIH-1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant full length protein (His-T7-tag) corresponding to Human HIF1AN/FIH-1 aa 2-349. Expressed in E.coli. N-terminal tags.
    Sequence:

    AATAAEAVASGSGEPREEAGALGPAWDESQLRSYSFPTRPIPRLSQSDPR AEELIENEEPVVLTDTNLVYPALKWDLEYLQENIGNGDFSVYSASTHKFL YYDEKKMANFQNFKPRSNREEMKFHEFVEKLQDIQQRGGEERLYLQQTLN DTVGRKIVMDFLGFNWNWINKQQGKRGWGQLTSNLLLIGMEGNVTPAHYD EQQNFFAQIKGYKRCILFPPDQFECLYPYPVHHPCDRQSQVDFDNPDYER FPNFQNVVGYETVVGPGDVLYIPMYWWHHIESLLNGGITITVNFWYKGAP TPKRIEYPLKAHQKVAIMRNIEKMLGEALGNPQEVGPLLNTMIKGRYN


    Database link: Q9NWT6

  • Positive control

    • IHC-P: Human prostate, stomach cancer, stomach and skin cancer tissues. ICC/IF: HeLa cells. WB: HeLa and HEK-293T cell lysates; Pig kidney and brain lysates; Recombinant human HIF1AN/FIH-1 protein.
  • General notes

    Previously labelled as HIF1AN.

Properties

Applications

Our Abpromise guarantee covers the use of ab233141 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.2 - 2 µg/ml. Predicted molecular weight: 40 kDa.
IHC-P Use a concentration of 5 - 20 µg/ml.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Hydroxylates HIF-1 alpha at 'Asp-803' in the C-terminal transactivation domain (CAD). Functions as an oxygen sensor and, under normoxic conditions, the hydroxylation prevents interaction of HIF-1 with transcriptional coactivators including Cbp/p300-interacting transactivator. Involved in transcriptional repression through interaction with HIF1A, VHL and histone deacetylases.
  • Sequence similarities

    Contains 1 JmjC domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt
  • Database links

  • Alternative names

    • DKFZp762F1811 antibody
    • Factor inhibiting HIF-1 antibody
    • Factor inhibiting HIF1 antibody
    • FIH 1 antibody
    • FIH-1 antibody
    • FIH1 antibody
    • FLJ20615 antibody
    • FLJ22027 antibody
    • HIF1AN antibody
    • HIF1N_HUMAN antibody
    • Hypoxia inducible factor 1 alpha inhibitor antibody
    • Hypoxia inducible factor 1 alpha subunit inhibitor antibody
    • Hypoxia inducible factor asparagine hydroxylase antibody
    • Hypoxia-inducible factor 1-alpha inhibitor antibody
    • Hypoxia-inducible factor asparagine hydroxylase antibody
    • Peptide aspartate beta dioxygenase antibody
    see all

Images

  • All lanes : Anti-HIF1AN/FIH-1 antibody (ab233141) at 2 µg/ml

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : HEK-293T (human epithelial cell line from embryonic kidney transformed with large T antigen) cell lysate
    Lane 3 : Pig kidney lysate
    Lane 4 : Pig brain lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 40 kDa

  • Paraffin-embedded human prostate tissue stained for HIF1AN/FIH-1 using ab233141 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human stomach cancer tissue stained for HIF1AN/FIH-1 using ab233141 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human stomach tissue stained for HIF1AN/FIH-1 using ab233141 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for HIF1AN/FIH-1 using ab233141 at 10 µg/ml in immunohistochemical analysis.

    Secondary used: HRP-Linked Goat anti-Rabbit IgG polyclonal at 2 µg/ml. DAB staining.

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for HIF1AN/FIH-1 (green) using ab233141 at 20 µg/ml in ICC/IF, followed by FITC staining.

  • Anti-HIF1AN/FIH-1 antibody (ab233141) at 2 µg/ml + Recombinant human HIF1AN/FIH-1 protein

    Secondary
    HRP-Linked Guinea pig Anti-Rabbit at 1/2000 dilution

    Predicted band size: 40 kDa

References

ab233141 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233141.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up