Overview

  • Product name

  • Description

    Rabbit polyclonal to HINT2
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
    Predicted to work with: Mouse, Rat, Cow
  • Immunogen

    Recombinant fragment corresponding to Human HINT2 aa 33-84.
    Sequence:

    GVTDGNEVAKAQQATPGGAAPTIFSRILDKSLPADILYEDQQCLVFRDVA PQ


    Database link: Q9BX68

  • Positive control

    • Human kidney tissue; U-2 OS cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.20
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, 59% PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab220935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100.

IHC-P 1/50 - 1/200. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Function

    Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity.
  • Tissue specificity

    High expression in liver and pancreas. Expression is significantly down-regulated in hepatocellular carcinoma (HCC) patients.
  • Sequence similarities

    Belongs to the HINT family.
    Contains 1 HIT domain.
  • Domain

    The histidine triad, also called HIT motif, forms part of the binding loop for the alpha-phosphate of purine mononucleotide.
  • Cellular localization

    Mitochondrion.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1190005L05Rik antibody
    • HINT-2 antibody
    • HINT-3 antibody
    • HINT2 antibody
    • HINT2_HUMAN antibody
    • histidine triad nucleotide binding protein 2 antibody
    • Histidine triad nucleotide-binding protein 2 antibody
    • HIT-17 antibody
    • HIT-17kDa antibody
    • mitochondrial antibody
    • PKCI-1-related HIT protein antibody
    • Protein kinase C inhibitor 2 antibody
    see all

Images

  • Immunofluorescent analysis of PFA-fixed/Triton X-100 permeabilized U-2 OS cells labeling HINT2 with ab220935 at 4 µg/mL (green).

  • Immunohistochemical analysis of paraffin-embedded human kidney tissue labeling HINT2 with ab220935 at 1/50 dilution.

References

ab220935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up