Overview

  • Product name

  • Description

    Rabbit polyclonal to HIP1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HIP1 aa 410-690.
    Sequence:

    SELEADLAEQQHLRQQAADDCEFLRAELDELRRQREDTEKAQRSLSEIER KAQANEQRYSKLKEKYSELVQNHADLLRKNAEVTKQVSMARQAQVDLERE KKELEDSLERISDQGQRKTQEQLEVLESLKQELATSQRELQVLQGSLETS AQSEANWAAEFAELEKERDSLVSGAAHREEELSALRKELQDTQLKLASTE ESMCQLAKDQRKMLLVGSRKAAEQVIQDALNQLEEPPLISCAGSADHLLS TVTSISSCIEQLEKSWSQYLACPEDISGLLH


    Database link: O00291

  • Positive control

    • IHC-P: Human colon cancer and placenta tissue.
  • General notes

    Previously labelled as Huntingtin Interacting Protein HIP1.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 50% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab238890 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.

Target

  • Function

    Plays a role in clathrin-mediated endocytosis and trafficking. Involved in regulating AMPA receptor trafficking in the central nervous system in an NMDA-dependent manner. Enhances androgen receptor (AR)-mediated transcription. May act as a proapoptotic protein that induces cell death by acting through the intrinsic apoptosis pathway. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis. May play a functional role in the cell filament networks. May be required for differentiation, proliferation, and/or survival of somatic and germline progenitors.
  • Tissue specificity

    Ubiquitously expressed with the highest level in brain. Expression is up-regulated in prostate and colon cancer.
  • Involvement in disease

    Note=A chromosomal aberration involving HIP1 is found in a form of chronic myelomonocytic leukemia (CMML). Translocation t(5;7)(q33;q11.2) with PDGFRB. The chimeric HIP1-PDGFRB transcript results from an in-frame fusion of the two genes. The reciprocal PDGFRB-HIP1 transcript is not expressed.
  • Sequence similarities

    Belongs to the SLA2 family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 1 I/LWEQ domain.
  • Domain

    The pseudo DED region (pDED) mediates the interaction with IFT57.
    Binds F-actin via the talin-like I/LWEQ domain.
  • Cellular localization

    Cytoplasm. Nucleus. Endomembrane system. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Shuttles between cytoplasm and nucleus. Nuclear translocation can be induced by AR.
  • Information by UniProt
  • Database links

  • Alternative names

    • 2610109B09Rik antibody
    • A930014B11Rik antibody
    • E130315I21Rik antibody
    • HIP 1 antibody
    • HIP I antibody
    • HIP-1 antibody
    • HIP-I antibody
    • hip1 antibody
    • HIP1/PDGFRB fusion gene antibody
    • HIP1/PDGFRB fusion gene, included antibody
    • HIP1_HUMAN antibody
    • HIPI antibody
    • Huntingtin interacting protein 1 antibody
    • Huntingtin Interacting Protein HIP1 antibody
    • Huntingtin-interacting protein 1 antibody
    • Huntingtin-interacting protein I antibody
    • ILWEQ antibody
    • KIAA4113 antibody
    • MGC126506 antibody
    • MGC27616 antibody
    • mKIAA4113 antibody
    see all

Images

  • Paraffin-embedded human colon cancer tissue stained for HIP1 with ab238890 at a 1/100 dilution in immunohistochemical analysis.

  • Paraffin-embedded human placenta tissue stained for HIP1 with ab238890 at a 1/100 dilution in immunohistochemical analysis.

References

ab238890 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab238890.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up