Overview

  • Product name

  • Description

    Rabbit polyclonal to HIP1R
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, ICC/IFmore details
  • Species reactivity

    Reacts with: Human, Pig
    Predicted to work with: Mouse
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HIP1R aa 771-1012. Expressed in E. coli. N-terminal tags.
    Sequence:

    SLDVRQEELGAVVDKEMAATSAAIEDAVRRIEDMMNQARHASSGVKLEVN ERILNSCTDLMKAIRLLVTTSTSLQKEIVESGRGAATQQEFYAKNSRWTE GLISASKAVGWGATQLVEAADKVVLHTGKYEELIVCSHEIAASTAQLVAA SKVKANKHSPHLSRLQECSRTVNERAANVVASTKSGQEQIEDRDTMDFSG LSLIKLKKQEMETQVRVLELEKTLEAERMRLGELRKQHYVLA


    Database link: O75146

  • Positive control

    • WB: Recombinant human HIP1R protein; pig kidney and brain tissue lysate; HeLa whole cell lysate. ICC/IF: HeLa cells.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein A purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232808 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use a concentration of 0.5 - 2 µg/ml. Predicted molecular weight: 119 kDa.
ICC/IF Use a concentration of 5 - 20 µg/ml.

Target

  • Function

    Component of clathrin-coated pits and vesicles, that may link the endocytic machinery to the actin cytoskeleton. Binds 3-phosphoinositides (via ENTH domain). May act through the ENTH domain to promote cell survival by stabilizing receptor tyrosine kinases following ligand-induced endocytosis.
  • Tissue specificity

    Brain, heart, kidney, pancreas, and liver, but not in lung or placenta.
  • Sequence similarities

    Belongs to the SLA2 family.
    Contains 1 ENTH (epsin N-terminal homology) domain.
    Contains 1 I/LWEQ domain.
  • Domain

    Binds F-actin via the talin-like I/LWEQ domain.
  • Cellular localization

    Cytoplasm > perinuclear region. Endomembrane system. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Membrane-associated protein, mainly localized at the endocytic compartments and in the perinuclear region.
  • Information by UniProt
  • Database links

  • Alternative names

    • FLJ14000 antibody
    • FLJ27022 antibody
    • HIP-12 antibody
    • Hip1 related antibody
    • HIP1-related protein antibody
    • HIP12 antibody
    • HIP1R antibody
    • HIP1R_HUMAN antibody
    • HIP3 antibody
    • Huntingtin Interacting Protein 1 Related antibody
    • Huntingtin interacting protein 12 antibody
    • Huntingtin-interacting protein 1-related protein antibody
    • Huntingtin-interacting protein 12 antibody
    • ILWEQ antibody
    • KIAA0655 antibody
    • MGC47513 antibody
    see all

Images

  • All lanes : Anti-HIP1R antibody (ab232808) at 3 µg/ml

    Lane 1 : Pig kidney tissue lysate
    Lane 2 : HeLa (human epithelial cell line from cervix adenocarcinoma) whole cell lysate
    Lane 3 : Pig brain tissue lysate

    Secondary
    All lanes : HRP-linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 119 kDa

  • HeLa (human epithelial cell line from cervix adenocarcinoma) cells stained for HIP1R (green) using ab232808 at 20 μg/ml in ICC/IF. FITC stained.

  • Anti-HIP1R antibody (ab232808) at 2 µg/ml + Recombinant human HIP1R protein

    Predicted band size: 119 kDa

References

ab232808 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232808.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up