Anti-Histone H1t2 antibody - N-terminal (ab184838)
Key features and details
- Rabbit polyclonal to Histone H1t2 - N-terminal
- Suitable for: IHC-P
- Reacts with: Human
- Isotype: IgG
Overview
-
Product name
Anti-Histone H1t2 antibody - N-terminal
See all Histone H1t2 primary antibodies -
Description
Rabbit polyclonal to Histone H1t2 - N-terminal -
Host species
Rabbit -
Tested applications
Suitable for: IHC-Pmore details -
Species reactivity
Reacts with: Human -
Immunogen
Recombinant fragment corresponding to Human Histone H1t2 aa 1-94 (N terminal).
Sequence:MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPS RGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
Database link: Q75WM6 -
Positive control
- IHC-P: Human testis tissue.
-
General notes
Reproducibility is key to advancing scientific discovery and accelerating scientists’ next breakthrough.
Abcam is leading the way with our range of recombinant antibodies, knockout-validated antibodies and knockout cell lines, all of which support improved reproducibility.
We are also planning to innovate the way in which we present recommended applications and species on our product datasheets, so that only applications & species that have been tested in our own labs, our suppliers or by selected trusted collaborators are covered by our Abpromise™ guarantee.
In preparation for this, we have started to update the applications & species that this product is Abpromise guaranteed for.
We are also updating the applications & species that this product has been “predicted to work with,” however this information is not covered by our Abpromise guarantee.
Applications & species from publications and Abreviews that have not been tested in our own labs or in those of our suppliers are not covered by the Abpromise guarantee.
Please check that this product meets your needs before purchasing. If you have any questions, special requirements or concerns, please send us an inquiry and/or contact our Support team ahead of purchase. Recommended alternatives for this product can be found below, as well as customer reviews and Q&As.
Properties
-
Form
Liquid -
Storage instructions
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle. -
Storage buffer
pH: 7.20
Preservative: 0.02% Sodium azide
Constituents: 59% PBS, 40% Glycerol (glycerin, glycerine) -
Concentration information loading...
-
Purity
Immunogen affinity purified -
Clonality
Polyclonal -
Isotype
IgG -
Research areas
Associated products
-
Compatible Secondaries
-
Isotype control
Applications
Our Abpromise guarantee covers the use of ab184838 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
Application | Abreviews | Notes |
---|---|---|
IHC-P | 1/1000 - 1/2500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol. |
Target
-
Function
Essential for normal spermatogenesis and male fertility. Required for proper cell restructuring and DNA condensation during the elongation phase of spermiogenesis. Involved in the histone-protamine transition of sperm chromatin and the subsequent production of functional sperm. Binds both double-stranded and single-stranded DNA, ATP and protamine-1. -
Tissue specificity
Testis-specific. -
Sequence similarities
Belongs to the histone H1/H5 family. -
Cellular localization
Nucleus. Chromosome. In round and elongating spermatids, specifically localizes to a chromatin domain at the apical pole. - Information by UniProt
-
Database links
- Entrez Gene: 341567 Human
- SwissProt: Q75WM6 Human
- Unigene: 155833 Human
-
Alternative names
- H1 histone family member N testis specific antibody
- H1FNT antibody
- H1FNT_HUMAN antibody
see all
Images
Datasheets and documents
References (1)
ab184838 has been referenced in 1 publication.
- Li G et al. Meiotic defects and decreased expression of genes located around the chromosomal breakpoint in the testis of a patient with a novel 46,X,t(Y;1)(p11.3;p31) translocation. Int J Mol Med 40:367-377 (2017). IHC ; Human . PubMed: 28627638