Overview

  • Product name
    Anti-HIV1 gp120 antibody (Biotin)
    See all HIV1 gp120 primary antibodies
  • Description
    Goat polyclonal to HIV1 gp120 (Biotin)
  • Host species
    Goat
  • Conjugation
    Biotin
  • Tested applications
    Suitable for: WB, ELISA, IHC-Fr, ICC/IFmore details
  • Species reactivity
    Reacts with Human Immunodeficiency Virus 1 Gp120.
  • Immunogen

    Full length native protein (purified) corresponding to HIV1 gp120. Purified native gp120 from strain IIIB.

Properties

Applications

Our Abpromise guarantee covers the use of ab53937 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent dilution.
ELISA Use at an assay dependent dilution.
IHC-Fr Use at an assay dependent dilution.
ICC/IF Use at an assay dependent dilution.

Target

  • Relevance
    HIV1 is equipped with the envelope gp160 glycoprotein for interaction with Langerhans cells (LCs) and dendritic cells (DCs), the members of the innate immune system, which confront the virus at the portal of virus entry in the human body. These cells are equipped with receptors by which they bind and endocytose the virus. The gp120 glycoprotein is used for binding to CD4 receptor and CCR5 co-receptor of T helper 2 (Th2) cells, and is able to induce FcepsilonRI(+) hematopoietic cells to produce IL4, which inactivates the host adaptive immune response.
  • Cellular localization
    Envelope surface glycoprotein.
  • Alternative names
    • Glycoprotein 120 antibody
    • gp120 antibody
    • SU antibody
    • Surface protein antibody

References

This product has been referenced in:
  • Beraud C  et al. Reassessment of the capacity of the HIV-1 Env cytoplasmic domain to trigger NF-?B activation. Virol J 15:35 (2018). Read more (PubMed: 29454367) »
  • Safavieh M  et al. Paper microchip with a graphene-modified silver nano-composite electrode for electrical sensing of microbial pathogens. Nanoscale 9:1852-1861 (2017). Read more (PubMed: 27845796) »
See all 9 Publications for this product

Customer reviews and Q&As

1-9 of 9 Abreviews or Q&A

Answer

Vielen Dank für Ihre Anfrage.

Leider muss ich Ihnen mitteilen, dass dies nicht zu unseren Standartmethoden gehört, wenn wir einen Antikörper entwickeln und charakterisieren.

Was Sie allerdings machen könnten, wenn Sie diesen Antikörper bereits erworben haben um das ungefähre Gewicht zu ermitteln, wäre einen WB unter Nicht-reduzierenden Bedingungen, also ohne beta-Mercapthoethanol oder DTT Zugabe, mit dem Antikörper als Probe laufen zu lassen: Der Antikörper sollte sich (zum größten Teil) nicht in die leichte und schwere Kette aufspalten, und die Biotin-Konkugationsollte ebenfalls erhalten bleiben.

Ich hoffe, dies hilft Ihnen trotzdem weiter. Bitte zögern Sie nicht, sich wieder bei uns zu melden, falls Sie weitere Fragen haben.

Benutzen Sie unsere Produkte? Schicken Sie uns einen Abreview. Verdienen Sie sich eine Belohnung!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for contacting us.

I am sorry that this antibody did not perform as stated on the datasheet. If payment has already been made on the original order and you wish to receive a refund, please ask your purchasing department to contact our accounting department so that we may gather the correct information needed for the refund. To avoid confusion, please ensure your accounts department is aware of how the credit note is being used.

Our accounting department can be contacted by email at us.credits@abcam.com or by telephone using the information at the Contact Us link in the top right corner of our website. Please refer to the credit note ID in any correspondence with our accounting department.


I hope this experience will not prevent you from purchasing other products from us in the future. Our Scientific Support team is always at your service, should you require further expert advice.

Read More

Answer

Thank you for your enquiry and your interest in our products.
This antibody has not been tested against the HXB2 or JRFL strains yet. However, given the polyclonal nature of the antibody, there is a good chance it would react to these strains but currently we do not have any empirical data to support this.
If you need any further assistance in the future, please do not hesitate to contact me.

Read More

Answer

Gracias por contactarnos.

Anti-HIV1 p24 [39/5.4A] (ab9071) tiene un precio de 370€ y se encuentra actualmente en stock, por lo que si lo pedís esta tarde o mañana (martes 12) a lo largo del día (antes de las 17 horas) lo recibiréis al día siguiente o en dos días como máximo.

Anti-HIV1 gp120 antibody (Biotin) (ab53937) tiene el mismo precio (370€), pero no está en stock en nuestro almacén de Inglaterra, por lo que tardaría alrededor de una semana en llegaros.

Si necesitáis un presupuesto, información sobre descuentos y promociones o mas información acerca de nuestros productos podéis contactarnos por teléfono (91 114 65 54) o por correo electrónico (mailto:orders@abcam.com).

Para realizar un pedido, escribir a la dirección indicada un mail con los productos requeridos, direcciones de envío y facturación, teléfono de contacto, y CIF de la Universidad.

Si necesitas más información, estaremos encantados de poder ayudarte.

Read More

Question
Answer

Thank you for contacting us. This product is raised from purified native gp120 from strain IIIB. We have not sequenced the native protein used to raise this antibody. We have searched, and unfortunately, the gp120 sequence has not been submitted for strain IIIB. Linked below is the entire genome for strain IIIB. gp120 is encoded by the env gene, but without knowing for sure which promoter and reading frame is used for this strain we cannot send specifically the gp120 sequence. http://www.hiv.lanl.gov/components/sequence/HIV/asearch/query_one.comp?se_id=18154 I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information. Use our products? Submit an Abreview. Earn rewards! https://www.abcam.com/abreviews

Read More

Question
Answer

Thank you for contacting us.

Here is the sequence you requested:

gp120 [Human immunodeficiency virus 1]
GenBank: AAF69493.1
GenPept Graphics





>gi|7769646|gb|AAF69493.1|AF236860_1 gp120 [Human immunodeficiency virus 1]
VPVWKDAETTLFCASDAKAHETEVHNVWATHACVPTDPNPQEIQLKNVTENFNMWKNNMVEQMQEDVISL
WDQSLKPCVKLTPLCVTLNCTDATLTNSTYITNVSKIIGDITEEVRNCSFNMTTELRDKKQKVHALFL


I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.


Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Answer

Thank you for your reply. To reduce the non-specific binding of your secondary antibody, you could: - Change your blocking agent, to either 5% non fat dried milk or 5% BSA. - Lower the concentration of the secondary antibody that you are using. - Add between 0.1-0.55 Tween20 to the secondary antibody solution. - Increase the number of wash steps that you are currently using. Hopefully some of the protocol tips would help alleviate the problem. If you continue to see non-specific binding of the secondary antibody, then if you purchased it from Abcam, I would be happy to send a replacement. If you purchased it from another company, then I would suggest contacting them and asking them for a replacement antibody. Please let me know if there is anything else I can help you with.

Read More

Answer

Thank you for contacting Abcam. I just want to make sure that I understand your negative control correctly; for your negative control, you added the secondary antibody only (no primary antibody) and that is the lane labeled 'gp120 negative'. Is that correct? If so, then I believe that the issue is that your secondary antibody is non-specifically binding to the other bands, as you are seeing the same banding pattern, in the secondary only lane (no ab53937 present). If I am reading your image incorrectly, I do apologize. Would you be able to send me more information on the protocol you used, including the samples that were loaded onto the gel. By sending this extra information, I will hopefully be able to help you more. I look forward to your reply.

Read More

Answer

Thank you for your enquiry. These 4 products (ab21179, ab20105, ab20262, ab20008) were produced from the same goat antiserum. Catalog ab21179 is the purified antibody. The purified antibody is then labeled to produce the other catalog numbers: Biotin (ab20105), FITC (ab20262), HRP (ab20008). Meanwhile, ab53840 and ab53937 originate from the same goat antisera. Unfortunately, we do not have the unconjugated version of these antibodies in our catalog but I may check with the originator if it is available. Please let me know if you would like to proceed with an order.

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up