Anti-HIV1 integrase antibody [IN-2] (ab66645)

Overview

  • Product name
    Anti-HIV1 integrase antibody [IN-2]
  • Description
    Mouse monoclonal [IN-2] to HIV1 integrase
  • Host species
    Mouse
  • Specificity
    ab66645 is specific for bacterial HIV1 integrase (IN) protein.
  • Tested applications
    Suitable for: WB, ICC/IF, IPmore details
  • Species reactivity
    Reacts with HIV1.
  • Immunogen

    Bacterially expressed, hexahistidine amino-terminal tagged HIV1 integrase (IN) protein (clade B, HXB-3 isolate)

Properties

Applications

Our Abpromise guarantee covers the use of ab66645 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/2000. Predicted molecular weight: 32 kDa.
ICC/IF Use at an assay dependent dilution.
IP Use at an assay dependent dilution.

Target

  • Relevance
    Integrase is an enzyme, a product of the HIV1 Gag/Pol gene; the other two enzymes being reverse transcriptase and protease. The human immunodeficiency virus (HIV-1) uses an enzyme, a so-called integrase, to carry out the integration of its viral DNA into the host chromosome thereby tricking the host cell machinery into making viral proteins. The HIV-1 integrase is a protein of 32 kDa and is composed of three domains. No cellular homologue of HIV integrase has been described, so potential inhibitors to this enzyme could be relatively nontoxic.
  • Alternative names
    • HIV antibody
    • Human Immunodeficiency virus 1 antibody
    • IN antibody
    • Integrase antibody

Images

  • ab66645 staining HIV1 integrase in transfected 293T by ICC/IF (Immunocytochemistry/immunofluorescence). Cells were fixed with methanol/acetone (1:1), permeabilized with 0.1% Triton X-100 and blocked with 3% BSA for 1 hour at 22°C. Samples were incubated with primary antibody (1/1000 in PBS + 1% BSA) for 1 hour at 21°C. An Alexa Fluor® 555-conjugated Goat anti-mouse IgG polyclonal was used as the secondary antibody (1/2000).

    See Abreview

References

This product has been referenced in:
  • Saleh S  et al. HIV integration and the establishment of latency in CCL19-treated resting CD4(+) T cells require activation of NF-?B. Retrovirology 13:49 (2016). IP ; Human . Read more (PubMed: 27459960) »
  • Desimmie BA  et al. HIV-1 IN/Pol recruits LEDGF/p75 into viral particles. Retrovirology 12:16 (2015). Read more (PubMed: 25809198) »

See all 4 Publications for this product

Customer reviews and Q&As

Abcam guarantees this product to work in the species/application used in this Abreview.
Application
Immunoprecipitation
Sample
Human Cell lysate - whole cell (293T)
Total protein in input
5 µg
Immuno-precipitation step
Protein A/G
Specification
293T
Username

Abcam user community

Verified customer

Submitted Jun 15 2018

Application
Western blot
Sample
Human Recombinant protein (Recombinant protein)
Gel Running Conditions
Non-reduced Denaturing (12)
Loading amount
0.1 µg
Specification
Recombinant protein
Blocking step
Milk as blocking agent for 12 hour(s) and 0 minute(s) · Concentration: 5% · Temperature: 4°C
Username

Abcam user community

Verified customer

Submitted Oct 10 2017

Application
Immunocytochemistry/ Immunofluorescence
Sample
Human Cell (transfected 293T)
Permeabilization
Yes - 0.1% Triton X100
Specification
transfected 293T
Blocking step
BSA as blocking agent for 1 hour(s) and 0 minute(s) · Concentration: 3% · Temperature: 22°C
Fixative
Formaldehyde
Username

Abcam user community

Verified customer

Submitted Oct 10 2017

Thank you for contacting us. The amino acid sequence we used to produce this antibody is "FLDGIDKAQDEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGIWQL". This sequence is compatible to the amino acid 1148 to 1210 of Gag-Pol protein clad B P04585....

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up