Overview

  • Product name

  • Description

    Rabbit polyclonal to HJURP
  • Host species

    Rabbit
  • Tested applications

    Suitable for: ICC/IF, IHC-Pmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HJURP aa 47-177.
    Sequence:

    TPVVQMATLTYETPQGLRIWGGRLIKERNEGEIQDSSMKPADRTDGSVQA AAWGPELPSHRTVLGADSKSGEVDATSDQEESVAWALAPAVPQSPLKNEL RRKYLTQVDILLQGAEYFECAGNRAGRDVRV


    Database link: Q8NCD3

  • Positive control

    • ICC/IF: A431 cells. IHC-P: Human lymph node, testis, skin and stomach tissue.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.2
    Preservative: 0.02% Sodium azide
    Constituents: 40% Glycerol, PBS
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab224076 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
ICC/IF Use a concentration of 1 - 4 µg/ml.

Fixation/Permeabilization: PFA/Triton X-100

IHC-P 1/200 - 1/500. Perform heat mediated antigen retrieval with citrate buffer pH 6 before commencing with IHC staining protocol.

Target

  • Relevance

    Centromeric protein that plays a central role in the incorporation and maintenance of histone H3-like variant CENPA at centromeres. Acts as a specific chaperone for CENPA and is required for the incorporation of newly synthesized CENPA molecules into nucleosomes at replicated centromeres. Directly binds Holliday junctions.
  • Cellular localization

    Nucleus; nucleolus. Centromere. Note: Localizes in centromeres during late telophase and early G1, when CENPA nucleosomes are assembled. Localizes to nucleolus during S phase, nucleolus site being often related to storage.
  • Database links

  • Alternative names

    • 14-3-3-associated AKT substrate antibody
    • FAKTS antibody
    • fetal liver expressing gene 1 antibody
    • Fetal liver-expressing gene 1 protein antibody
    • FLEG1 antibody
    • hFLEG1 antibody
    • HJURP antibody
    • Holliday junction recognition protein antibody
    • Up-regulated in lung cancer 9 antibody
    • URLC9 antibody
    see all

Images

  • PFA-fixed, Triton X-100 permeabilized A431 (human epidermoid carcinoma cell line) cells stained for HJURP (green) using ab224076 (4 µg/ml) in ICC/IF.

  • Paraffin embedded human stomach tissue stained for HJURP with ab224076 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded human skin tissue stained for HJURP with ab224076 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded human testis tissue stained for HJURP with ab224076 (1/200 dilution) in immunohistochemical analysis.

  • Paraffin embedded human lymph node tissue stained for HJURP with ab224076 (1/200 dilution) in immunohistochemical analysis.

References

This product has been referenced in:

  • Xiang Y  et al. In vitro expansion affects the response of human bone marrow stromal cells to irradiation. Stem Cell Res Ther 10:82 (2019). Read more (PubMed: 30850008) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab224076.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up