Overview

  • Product name

  • Description

    Rabbit polyclonal to HLA B
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment (His-tag) corresponding to Human HLA B aa 26-309. (Expressed in E.coli)
    Sequence:

    SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAPW IEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYGC DVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAR VAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATL RCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPS GEEQRYTCHVQHEGLPKPLTLRWEPSSQSTVPIV


    Database link: P03989

  • Positive control

    • IHC-P: Human liver cancer, prostate, kidney, stomach, cerebrum and liver tissue. WB: Recombinant human HLA B protein; HeLa cell lysate; Pig spleen and lymph node tissue lysates.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    Antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 40 kDa.

Target

  • Function

    Involved in the presentation of foreign antigens to the immune system.
  • Sequence similarities

    Belongs to the MHC class I family.
    Contains 1 Ig-like C1-type (immunoglobulin-like) domain.
  • Post-translational
    modifications

    Polyubiquitinated in a post ER compartment by interaction with human herpesvirus 8 MIR1 protein. This targets the protein for rapid degradation via the ubiquitin system.
  • Cellular localization

    Membrane.
  • Information by UniProt
  • Database links

  • Alternative names

    • 1B07_HUMAN antibody
    • AS antibody
    • B-4901 antibody
    • B-7 alpha chain antibody
    • HC class I antigen SHCHA antibody
    • HLA class I histocompatibility antigen antibody
    • HLA class I histocompatibility antigen, B alpha chain antibody
    • HLA-B antibody
    • HLA-B histocompatibility type antibody
    • HLAB antibody
    • leukocyte antigen class I-B antibody
    • major histocompatibility complex, class I, B antibody
    • MHC class 1 antigen antibody
    • MHC class I antigen B*7 antibody
    • MHC class I antigen HLA-B alpha chain antibody
    • MHC class I antigen HLA-B heavy chain antibody
    • MHC Class I HLA heavy chain antibody
    • MHC class I molecule antibody
    • MHC HLA-B cell surface glycoprotein antibody
    • MHC HLA-B transmembrane glycoprotein antibody
    • SPDA1 antibody
    see all

Images

  • Anti-HLA B antibody (ab232741) at 5 µg/ml + Recombinant human HLA B protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 40 kDa

  • All lanes : Anti-HLA B antibody (ab232741) at 1/2000 dilution

    Lane 1 : HeLa (human epithelial cell line from cervix adenocarcinoma) cell lysate
    Lane 2 : Pig spleen tissue lysate
    Lane 3 : Pig lymph node tissue lysate

    Secondary
    All lanes : HRP-Linked Guinea pig Anti-Rabbit Ab at 1/2000 dilution

    Predicted band size: 40 kDa

  • Formalin-fixed, paraffin-embedded human liver tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human cerebrum tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human stomach tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human kidney tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human prostate tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

  • Formalin-fixed, paraffin-embedded human liver cancer tissue stained for HLA B using ab232741 at 20 ug/ml in immunohistochemical analysis. DAB staining.

References

ab232741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up