Overview

  • Product name

  • Description

    Rabbit polyclonal to HLA-C
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WBmore details
  • Species reactivity

    Reacts with: Human, Pig
  • Immunogen

    Recombinant fragment (His-T7-tag) corresponding to Human HLA-C aa 48-305. (Expressed in E.coli).
    Sequence:

    SVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQA DRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGPDGRLLRGYDQSAYDGKDY IALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTCVEWLRRYLE NGKETLQRAEPPKTHVTHHPLSDHEATLRCWALGFYPAEITLTWQRDGED QTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRYTCHMQHEGLQEPLTLS WEPSSQPT


    Database link: P10321

  • Positive control

    • WB: Recombinant human HLA-C protein; Human lymphocyte lysate; A431 cell lysate; Pig liver lysate. IHC-P: Human lung cancer, liver, kidney, prostate, skin cancer and stomach tissues.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.40
    Preservative: 0.02% Sodium azide
    Constituents: PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Purification notes

    ab232903 was purified by antigen-specific affinity chromatography followed by Protein A affinity chromatography.
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab232903 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P Use a concentration of 5 - 20 µg/ml.
WB Use a concentration of 1 - 5 µg/ml. Predicted molecular weight: 41 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 1C07_HUMAN antibody
    • Cw-7 alpha chain antibody
    • D6S204 antibody
    • HLA class I histocompatibility antigen antibody
    • HLA class I histocompatibility antigen, C alpha chain antibody
    • HLA class I histocompatibility antigen, Cw-1 alpha chain antibody
    • HLA JY3 antibody
    • HLA-C antibody
    • HLA-C histocompatibility type antibody
    • HLA-Cw antibody
    • HLA-JY3 antibody
    • HLAC antibody
    • HLC C antibody
    • HLC-C antibody
    • human leukocyte antigen-C alpha chain antibody
    • major histocompatibility antigen HLA-C antibody
    • major histocompatibility complex, class I, C antibody
    • MHC class I antigen antibody
    • MHC class I antigen Cw 1 antibody
    • MHC class I antigen Cw*7 antibody
    • MHC class I antigen heavy chain HLA-C antibody
    • PSORS1 antibody
    see all

Images

  • Anti-HLA-C antibody (ab232903) at 2 µg/ml + Recombinant human HLA-C protein

    Secondary
    HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 41 kDa

  • All lanes : Anti-HLA-C antibody (ab232903) at 2 µg/ml

    Lane 1 : Human lymphocyte lysate
    Lane 2 : A431 (human epidermoid carcinoma cell line) cell lysate
    Lane 3 : Pig liver lysate

    Secondary
    All lanes : HRP-Linked Guinea pig anti-Rabbit at 1/2000 dilution

    Predicted band size: 41 kDa

  • Paraffin-embedded human lung cancer tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human liver tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human kidney tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human prostate tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human skin cancer tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

  • Paraffin-embedded human stomach tissue stained for HLA-C using ab232903 at 20 μg/ml in immunohistochemical analysis. DAB staining.

References

ab232903 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab232903.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up