Overview

  • Product name

    Anti-HLA-C antibody - Extracellular domain
    See all HLA-C primary antibodies
  • Description

    Rabbit polyclonal to HLA-C - Extracellular domain
  • Host species

    Rabbit
  • Tested applications

    Suitable for: IHC-P, WB, ICC/IF, ELISAmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA-C aa 25-308 (extracellular).
    Sequence:

    CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAP WVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSG CDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAA RAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP SGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPI


    Database link: P10321

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.4
    Preservative: 0.03% Proclin
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Protein G purified
  • Purification notes

    >95%
  • Clonality

    Polyclonal
  • Isotype

    IgG
  • Research areas

Applications

Our Abpromise guarantee covers the use of ab193432 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
IHC-P 1/20 - 1/200.
WB 1/500 - 1/5000. Predicted molecular weight: 41 kDa.
ICC/IF 1/50 - 1/200.
ELISA Use at an assay dependent concentration.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 1C07_HUMAN antibody
    • Cw-7 alpha chain antibody
    • D6S204 antibody
    • HLA class I histocompatibility antigen antibody
    • HLA class I histocompatibility antigen, C alpha chain antibody
    • HLA class I histocompatibility antigen, Cw-1 alpha chain antibody
    • HLA JY3 antibody
    • HLA-C antibody
    • HLA-C histocompatibility type antibody
    • HLA-Cw antibody
    • HLA-JY3 antibody
    • HLAC antibody
    • HLC C antibody
    • HLC-C antibody
    • human leukocyte antigen-C alpha chain antibody
    • major histocompatibility antigen HLA-C antibody
    • major histocompatibility complex, class I, C antibody
    • MHC class I antigen antibody
    • MHC class I antigen Cw 1 antibody
    • MHC class I antigen Cw*7 antibody
    • MHC class I antigen heavy chain HLA-C antibody
    • PSORS1 antibody
    see all

Images

  • All lanes : Anti-HLA-C antibody - Extracellular domain (ab193432) at 4 µg/ml

    Lane 1 : Jurkat whole cell lysate
    Lane 2 : HeLa whole cell lysate
    Lane 3 : HEK293 whole cell lysate

    Secondary
    All lanes : Goat polyclonal to rabbit IgG at 1/5000 dilution

    Predicted band size: 41 kDa
    Observed band size: 41 kDa

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human lymph node tissue labeling HLA-C with ab193432 at 1/100 dilution. 

  • Immunocytochemistry/ Immunofluorescence analysis of HeLa (Human epithelial carcinoma cell line) labeling HLA-C with ab193432 at 1/100.

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human tonsil tissue labeling HLA-C with ab193432 at 1/100 dilution.

References

ab193432 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193432.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up