Overview

  • Product name

    Anti-HLA-C antibody - Extracellular domain (FITC)
    See all HLA-C primary antibodies
  • Description

    Rabbit polyclonal to HLA-C - Extracellular domain (FITC)
  • Host species

    Rabbit
  • Conjugation

    FITC. Ex: 493nm, Em: 528nm
  • Tested applications

    Suitable for: WBmore details
  • Species reactivity

    Reacts with: Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA-C aa 25-308 (extracellular).
    Sequence:

    CSHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAP WVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSG CDLGPDGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAA RAAEQLRAYLEGTCVEWLRRYLENGKETLQRAEPPKTHVTHHPLSDHEAT LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVP SGQEQRYTCHMQHEGLQEPLTLSWEPSSQPTIPI


    Database link: P10321

Properties

Applications

Our Abpromise guarantee covers the use of ab193417 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB Use at an assay dependent concentration. Predicted molecular weight: 41 kDa.

Target

  • Information by UniProt
  • Database links

  • Alternative names

    • 1C07_HUMAN antibody
    • Cw-7 alpha chain antibody
    • D6S204 antibody
    • HLA class I histocompatibility antigen antibody
    • HLA class I histocompatibility antigen, C alpha chain antibody
    • HLA class I histocompatibility antigen, Cw-1 alpha chain antibody
    • HLA JY3 antibody
    • HLA-C antibody
    • HLA-C histocompatibility type antibody
    • HLA-Cw antibody
    • HLA-JY3 antibody
    • HLAC antibody
    • HLC C antibody
    • HLC-C antibody
    • human leukocyte antigen-C alpha chain antibody
    • major histocompatibility antigen HLA-C antibody
    • major histocompatibility complex, class I, C antibody
    • MHC class I antigen antibody
    • MHC class I antigen Cw 1 antibody
    • MHC class I antigen Cw*7 antibody
    • MHC class I antigen heavy chain HLA-C antibody
    • PSORS1 antibody
    see all

References

ab193417 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab193417.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up