Overview

  • Product name

    Anti-HLA Class I A1 antibody
  • Description

    Rabbit polyclonal to HLA Class I A1
  • Host species

    Rabbit
  • Tested applications

    Suitable for: WB, IHC-P, ICC/IFmore details
  • Species reactivity

    Reacts with: Mouse, Rat, Human
  • Immunogen

    Recombinant fragment corresponding to Human HLA Class I A1 aa 35-285.
    Sequence:

    SVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYW DQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFL RGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYL EGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYP AEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCH V


    Database link: P30443

  • Positive control

    • THP1, HeLa, DU145, SW480 and HepG2 cell extracts; Mouse liver extract.

Properties

  • Form

    Liquid
  • Storage instructions

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C long term. Avoid freeze / thaw cycle.
  • Storage buffer

    pH: 7.3
    Preservative: 0.02% Sodium azide
    Constituents: 49% PBS, 50% Glycerol
  • Concentration information loading...
  • Purity

    Immunogen affinity purified
  • Clonality

    Polyclonal
  • Isotype

    IgG

Applications

Our Abpromise guarantee covers the use of ab185706 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

Application Abreviews Notes
WB 1/500 - 1/2000. Predicted molecular weight: 41 kDa.
IHC-P 1/50 - 1/200.
ICC/IF Use at an assay dependent concentration.

Target

  • Cellular localization

    Membrane; Single-pass type I membrane protein
  • Database links

  • Alternative names

    • antigen presenting molecule antibody
    • FLJ26655 antibody
    • HLA class I histocompatibility antigen, A-1 alpha chain antibody
    • HLAA antibody
    • leukocyte antigen class I-A antibody
    • major histocompatibility complex, class I, A antibody
    • MHC class I antigen HLA-A heavy chain antibody
    see all

Images

  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse liver tissue labelling HLA Class I A1 with ab185706 at 1/500. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of mouse kidney tissue labelling HLA Class I A1 with ab185706 at 1/500. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human neurilemmoma tissue labelling HLA Class I A1 with ab185706 at 1/500. Magnification: 200x.
  • Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections) analysis of human endometrial cancer tissue labelling HLA Class I A1 with ab185706 at 1/500. Magnification: 200x.
  • Immunocytochemistry/Immunofluorescence analysis of U2OS cells using ab185706. Blue DAPI for nuclear staining.
  • All lanes : Anti-HLA Class I A1 antibody (ab185706) at 1/500 dilution

    Lane 1 : THP1 cell extract
    Lane 2 : HeLa cell extract
    Lane 3 : DU145 cell extract
    Lane 4 : SW480 cell extract
    Lane 5 : HepG2 cell extract
    Lane 6 : Mouse liver extract

    Predicted band size: 41 kDa

References

This product has been referenced in:

  • Chen X  et al. Decoy receptor-3 regulates inflammation and apoptosis via PI3K/AKT signaling pathway in coronary heart disease. Exp Ther Med 17:2614-2622 (2019). Read more (PubMed: 30906453) »
See 1 Publication for this product

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab185706.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up